CAZyme Information: MGYG000002688_01411

Basic Information

• Species: Borkfalkia sp900557285
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia sp900557285
• CAZyme ID: MGYG000002688_01411
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		93298.53	4.9599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002688	1832213	MAG	Canada	North America

• Gene Location: Start: 10; End: 2475 Strand: -

Full Sequence      

MSADLIFGDRFEKVNWWVEAYCEDILLCRSEQAVFERGNGGNFSVGKWIECPGYAGRVPI
FKKKFSVEKKIDKATLYITGLGYYVSYLNGVRTDTYYLKPLVSEYDDRPLDKILCYAPRP
SGKRIYYNVFDVGKYICLGNNELTVALGNGWYCNHEKEVEGNYSYGVPKTIFELKIEYAD
GESEYIGSDESCEAVQTNREATLFRGEKIDFRENVGELFKQAERVYHAKFCDPIPTGKPV
ASPQCGDVVANILQPAEIYRQESGLVLDFGKNHSGFLSLKMCGERGSTVRIIYGEGITPD
RRVDHFSTSWGILVQTDEFILSGDTDLFECEFTVHAYRYAEIIWEKPCECTEIVSKEVHS
RIDRYSEFSCSEKMLNEISKMCVQTFVSNMHGGIPSDCPHRERRGYTGDGQVTCEAVLYS
VQAEVFYRKWLQDILDAQDADTGFVPHTAPFSGGGGGPSWGYAVCEIPYRLYAWTGDKAV
LRDALPHIQKWVDYLLARRNKDGLVDREEWGWCLGEWFCPDEVRIPAEFVNTCVLVRSIK
MLQTTEKFLNLGTESYAGELTEVVRSINRAYLDEEGNYCKNDQGANLFALDAGIVPGQFE
QICWENCLEYFRVGKKFHVDTGIFGSKILFRMLFERGEAETALHILLGSDYPSYGYMLKQ
GATTLWECWTEDFSPDYYTAEGELCKGYPVSHNHPMFGSVLSSIYRFVAGLDLEETGITG
IIRVRPYAMRWISEAKARVNTVYGEAWVGWKSKNSVAELRFFVPYGCKAELDVNALPKEY
KVDDKKNLHFGYGEHCIILSRKELISDGIQGRNAGDQYANA

Enzyme Prediction     

No EC number prediction in MGYG000002688_01411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	262	771	2.4e-116	0.9841269841269841
CBM67	47	214	2.5e-16	0.8295454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.41e-76	363	708	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.92e-25	69	213	1	132	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.61e-13	266	342	9	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.91e-04	722	786	12	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98018.1	1.53e-134	30	771	108	856
AUS97255.1	6.65e-127	42	774	2	709
QBE96295.1	3.46e-126	47	769	125	828
QMW80401.1	3.76e-125	47	769	126	829
QIB56822.1	3.76e-125	47	769	126	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.24e-87	59	788	177	913	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.14e-69	43	775	287	996	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.09e-54	61	750	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3CIH_A	3.20e-07	256	517	185	442	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.60e-69	43	775	287	996	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	2.44e-66	49	774	177	907	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.04e-51	62	770	174	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	1.94e-51	12	803	115	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002688_01411.