CAZyme Information: MGYG000002786_01109

Basic Information

• Species: UMGS268 sp900540175
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; UMGS268; UMGS268 sp900540175
• CAZyme ID: MGYG000002786_01109
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		46157.57	5.2476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002786	1606694	MAG	United States	North America

• Gene Location: Start: 214; End: 1392 Strand: -

Full Sequence      

MNQEKKEQFLNYIDYLCRHSTLEKPLWNKEVLRGLKQPGWTYIDGCMMVGLAALYQHTQS
EQLLNYIENFVGQCVDEDGKVKVLYYDNYNRYTEDGCDSDPCNEAKVLYLLYEKTKKEKY
RKAIEFFMDKQVRRLPRVAGSFWHKVKYPNQIWLDGLYMIQPFFAQYTKQFENKQSYLDI
LYQLKNTFDLTWEDDRKLMVHGYDGQYDDEEERMIWADPKNGHSKIVWLRACGWYEMALV
DVYEIMEEEKYRAKLRPLIQQTIDGLLQYQDPKTKMFWQVVDEPGKEKNYVETSGSAMIS
YAILKAVRLNALPQRYRSVGEEIFEGILNTYFKKDDNGEYHLGGICIGAGLSASKTDAYC
GTYDMYVSRSIVEDDGKAIGPMILAYTEVDRK

Enzyme Prediction     

No EC number prediction in MGYG000002786_01109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	390	4.4e-87	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.48e-70	39	391	33	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	7.89e-58	36	391	23	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCV64366.1	1.70e-109	24	389	22	373
CCV66002.1	1.30e-106	11	389	6	372
QEN04316.1	4.65e-99	12	388	5	366
VCV21981.1	4.80e-98	12	391	7	372
ADU22672.1	5.62e-98	12	391	13	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	6.01e-66	40	390	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.51e-44	40	390	39	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.49e-43	40	390	29	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	4.56e-07	39	328	64	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.57e-07	39	330	65	332	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.92e-43	40	390	39	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.92e-33	162	388	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.92e-33	162	388	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002786_01109.