CAZyme Information: MGYG000002797_00789

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508
• CAZyme ID: MGYG000002797_00789
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		50901.2	4.4014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002797	1235752	MAG	United States	North America

• Gene Location: Start: 71; End: 1408 Strand: +

Full Sequence      

MNINSSKVSISGTAKHTEETFYLPFSEMETVYNIDVVYHPESNIVTVDSLDREQKMATST
KDTNIKYVPTIFSKTVDTVKQGSSMILIEERNGWAKVRTSQGIIGYTKDYGNVRTVREQM
ESKKQIEGNISMIWDYYSEYASAPARTEKIEGVNVVSPTFATLIRLGKGQIETNIRQAGE
NYITWAHNNGYKVWAMVSNNSMKETTSEILRDYTLRETLINNIVKLTMDYEIDGINIDFE
NIYQEDKEFFSRFIIELAPRLREYGKVLSVDVTAPDGSEDWSLCYDRNVIGREADYIIFM
GYDQYGATSPQEGTTAGADWVETNIKKFLGQEGVAPEKLILGMPFYTRLWKEQNGEVDST
VISMKNVDSVLPEGIQKTWNEDLKQNYVEYTEGGAVYKMWIEDLDSIKEKINLVKQYELA
GAAYWEKDMESDSVWSIIAEELQIP

Enzyme Prediction     

No EC number prediction in MGYG000002797_00789.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	103	430	1.3e-42	0.9290540540540541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.89e-59	152	435	25	310	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.63e-37	154	438	128	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	7.83e-27	207	429	83	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.30e-26	207	429	80	306	Glycosyl hydrolases family 18.
cd06549	GH18_trifunctional	4.99e-24	130	435	1	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSQ09420.1	3.95e-98	3	443	100	547
AYO32308.1	8.28e-98	3	445	80	529
CCP26620.1	5.14e-91	3	445	110	562
AEE91826.1	5.14e-91	3	445	110	562
QAT61358.1	7.17e-90	2	444	104	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	3.21e-21	196	426	76	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	6.90e-19	198	444	178	427	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
5JH8_A	1.91e-18	136	442	7	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	9.87e-18	193	444	173	429	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
6G9C_A	5.21e-13	200	430	113	373	Crystalstructure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	9.07e-25	169	438	66	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	6.62e-21	196	426	168	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O31682	1.80e-20	134	352	13	214	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P0DPJ9	2.76e-18	198	444	177	426	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	6.69e-18	198	444	177	426	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002797_00789.