CAZyme Information: MGYG000002861_00215

Basic Information

• Species: Megasphaera sp900539295
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp900539295
• CAZyme ID: MGYG000002861_00215
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		29318.68	9.2441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002861	2242985	MAG	United States	North America

• Gene Location: Start: 75905; End: 76699 Strand: -

Full Sequence      

MKRKYIAIFILAFVLCAGWNLLFDAPKTTKPPAGTTTRIKETTEPQGTWPAPLQPLEASL
YPYLHFHQAMDAKIKKIPVYVAIGAISKPMQHAVVATEDRRFYSHGAIDPIGIGRAILTN
IQSGETVEGGSTLSQQVVKNVFLSQDRTFARKAQEFVMAFLLEQNYSKDEILEIYLNTAY
FGANATGIDDAARTYFTTSPEKLDLAQSSMLAGLVQAPTYYNPLQNYPAAKARQKIVLTL
MTEQGYISPEQSNAAYKKDLGLQR

Enzyme Prediction     

No EC number prediction in MGYG000002861_00215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	79	241	1.8e-65	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.08e-87	79	242	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.70e-85	79	263	3	187	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.24e-81	79	264	77	263	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	9.44e-71	79	264	68	253	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.13e-48	75	255	65	243	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO26612.1	9.92e-155	1	262	1	262
ALG41193.1	9.92e-155	1	262	1	262
AVO73790.1	4.03e-154	1	262	1	262
CCC72322.1	4.03e-154	1	262	1	262
AXB81629.1	5.03e-112	1	264	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.29e-46	80	258	22	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.15e-46	80	258	22	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	4.49e-39	80	260	29	209	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
5U2G_A	1.85e-38	75	260	39	222	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
2OLU_A	2.65e-37	80	260	38	218	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	5.78e-47	80	262	97	283	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O87626	4.03e-44	80	264	70	254	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P38050	1.76e-43	81	262	70	251	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87579	1.94e-43	80	264	70	254	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
Q07259	2.17e-43	78	262	47	230	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.709978	0.067951	0.221264	0.000215	0.000153	0.000443

TMHMM  Annotations     

start	end
5	23