CAZyme Information: MGYG000002873_01027

Basic Information

• Species: CAG-495 sp900538765
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900538765
• CAZyme ID: MGYG000002873_01027
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000002873_12|CGC1	39296.02	5.6237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002873	1867269	MAG	United States	North America

• Gene Location: Start: 1323; End: 2405 Strand: -

Full Sequence      

MSRPVRAALVSVSSTELTSTEKSLLEKYNPLGVSLFNRNIATPQQLQKLIADIKETLGRE
DALIAVDQEGGRVRRLREPDFRAYAGQQTLGRLYTEVSPAAAQKAVKIQAALIAADLHSL
GINLNYAPVLDVRSPQTAPVLSSRIFSDTPQIVAELGKIMADEYMAQNIIPCIKHLPGHG
RAAVDPHLHLPVITAALPELENDFYPFKQLHRLPCGMTAHIVVAAVDDSAPVTQSPKAVR
ELIRGQIGFDGFLISDAIDMRALKGSLSEKTITALNAGCDAVCYCAGESNGLEEVCRAAR
PLTDDALERLPRMTAVLSAPKHEHNITALQEEYIQILGQIEAYDETYDATEVLFKMQQPN

Enzyme Prediction     

No EC number prediction in MGYG000002873_01027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	283	3.5e-38	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	7.76e-72	1	310	1	308	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.24e-51	9	332	5	335	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	3.87e-51	9	313	11	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10689.1	1.75e-107	7	356	4	337
QPC41685.1	3.70e-85	5	331	3	329
BBF92536.1	1.10e-82	4	320	2	318
ADG09912.1	2.34e-81	7	309	6	308
AVQ04366.1	2.34e-81	7	309	6	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TEV_A	8.66e-40	3	282	17	290	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3WO8_A	2.29e-38	22	278	32	280	Crystalstructure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]
7VI6_A	8.23e-37	8	285	4	277	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
4G6C_A	1.71e-36	9	335	15	338	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]
4GNV_A	1.78e-36	9	335	17	340	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4GNV_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4MSS_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],4MSS_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],5UTP_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTP_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTQ_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTQ_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTR_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],5UTR_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],6DTE_A GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia],6DTE_B GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2KXM7	5.20e-44	4	310	11	306	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q0A911	3.06e-40	9	339	7	338	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
Q7W9J5	9.64e-39	4	320	12	329	Beta-hexosaminidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=nagZ PE=3 SV=2
Q7WH65	9.64e-39	4	320	12	329	Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=nagZ PE=3 SV=1
Q2Y863	3.36e-38	9	285	7	283	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002873_01027.