CAZyme Information: MGYG000002898_01807

Basic Information

• Species: Haemophilus_D pittmaniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D pittmaniae
• CAZyme ID: MGYG000002898_01807
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167		19002.65	8.4403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002898	2077686	MAG	United States	North America

• Gene Location: Start: 23300; End: 23803 Strand: -

Full Sequence      

MSLSFQQIFDRLIGHEGGYVNDPHDTGGETIWGITKHTARENGYLGAMRTMTREQAFKIY
YSAFWLRYQCDKMPDAVAYQFFDTAVNHGLGNASRMLQRAVGVVDDGKIGQITLKAIREM
SISDVIMHLAAERLEFYCKLNNFSRYGKGWVRRVAGNLKYGAMDNEV

Enzyme Prediction     

No EC number prediction in MGYG000002898_01807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	9	89	1.7e-30	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3926	ZliS	5.49e-60	1	166	1	173	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	6.93e-43	4	89	2	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam05838	Glyco_hydro_108	1.67e-37	9	89	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
pfam09374	PG_binding_3	0.003	92	153	1	74	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH65470.1	8.41e-102	1	167	1	167
BBE81458.1	6.35e-97	1	167	1	167
AXP38832.1	6.35e-97	1	167	1	167
BBE83382.1	6.35e-97	1	167	1	167
BBF06607.1	7.40e-96	1	167	1	167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IS5_A	3.02e-66	5	165	6	166	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	3.12e-66	5	165	5	165	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
6V3Z_A	9.35e-25	7	118	24	149	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]
7DNP_A	1.24e-24	4	155	5	160	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
6V40_A	2.48e-20	7	117	22	146	ChainA, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_B Chain B, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_C Chain C, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_D Chain D, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002898_01807.