CAZyme Information: MGYG000002913_01598

Basic Information

• Species: UMGS1052 sp900548115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1052; UMGS1052 sp900548115
• CAZyme ID: MGYG000002913_01598
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		87304.55	4.8337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002913	2137677	MAG	United States	North America

• Gene Location: Start: 10116; End: 12431 Strand: -

Full Sequence      

MLSTKFISATREFATYEKTVAAPYLRRSFSLSALPEKADFTVTGLGFYRVFVNGKDITKG
LLAPYISNDDEVVYYDRYDLAPYLRVGKNTLAFLLGNGFHNCIGGNIWDLDKALYRSAPK
LAFALTLSDGTVIEADENVKTHPSPILFDDLRCGVHYDARKELSGWTSPDFDDSDWENAF
PVETARGKAVLCSAEPIRVYDELAPETITPHVFLAPYQHRDDHMPEKTFYDSAEDDAKEG
FLYDFGQNNAGIFRLKINGKAGQRIVLQACERLDEENRPFFSNIGFYPNGYSQRTIYICR
GEGEEIFTPDFTYIGYRYLWVSGITEEQATKELLTYLVAGSDLEARGDFSCSDEMANRLW
EISLRSDRANLYYFPTDCPHREKNGWTGDASISAEHMTLKLAMEKTYSDWLISIRGAQNQ
EGALPGIVPTAGWGFEWGNGPIWDSVAFNLPYYTYRYRGDKKIILDNAEMMMRYLHYVLT
KRDEKGLLHIGLGDWCPVGKGPGDYDVPLCFTDTVCVMDCARKAGRMLRAVGMTEQAEFA
DIAYTSLRRAIRENLIDFNTMTVLGSCQSAQAIALALDVFEPAEKSEAFTRLIEFIEQRD
EHFDTGFYGARYLFHVLSDFGAEELAYHMITRTDAPSFGFWIKNGATTLYESFEEGGLCG
ASLNHHFWGEYSAWFMRVILGINVNPKATDPKNVDIVPKFLEKLEHAEGYYDTVCGKLSV
SWKRDGDAVILNVTVPEGIYGTIKLPFGWRFENTDHAFRPLETVSVRVKSL

Enzyme Prediction     

No EC number prediction in MGYG000002913_01598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	238	745	3.2e-124	0.9880952380952381
CBM67	14	184	2.4e-29	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.21e-79	347	679	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.25e-35	35	199	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.15e-18	241	338	8	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.30e-07	692	746	10	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF16194.1	6.91e-134	14	746	164	862
QGQ94103.1	2.76e-131	17	752	138	847
AGA80189.1	5.18e-131	22	751	146	854
APO32478.1	3.41e-129	236	586	18	364
QMW03094.1	7.48e-128	22	746	157	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.71e-93	22	746	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.49e-76	21	746	301	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.64e-55	26	746	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.33e-83	21	736	183	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	3.23e-80	17	739	164	872	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	7.13e-76	21	746	301	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.27e-67	24	746	176	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002913_01598.