CAZyme Information: MGYG000002967_02040

Basic Information

• Species: Enterococcus_A pallens
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A pallens
• CAZyme ID: MGYG000002967_02040
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		23107.11	5.6396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002967	2610517	MAG	United States	North America

• Gene Location: Start: 63113; End: 63727 Strand: -

Full Sequence      

MPTKKYKKRKRKLSMPFIFAGLLLIGLAFVFSLHTLSEHAVEQSANNEQMTHEEFIQRLA
PRAKQLQQGYGILPSIILGQAILESNWGQSSLASQYNNLFGIKAYGNQPKITLETQEYVN
EAWVTIQGDFRVYDSWEASMDDHTLLFVNGTTWNPGLYEKVLTAANYQEAAQALQDAGYA
TDPTYAQKIISVIETYNLSQYDQP

Enzyme Prediction     

No EC number prediction in MGYG000002967_02040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	60	198	3.7e-40	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.79e-75	17	203	11	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.70e-40	53	204	321	474	amidase domain-containing protein.
smart00047	LYZ2	1.11e-39	52	202	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	4.13e-39	53	195	153	296	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	1.21e-36	53	193	149	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM18487.1	6.18e-106	1	202	1	202
AXG37986.1	1.77e-105	1	202	1	202
AYQ23607.1	2.51e-105	1	202	1	202
QCQ13336.1	2.51e-105	1	202	1	202
QXJ60493.1	3.56e-105	1	202	1	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.32e-28	30	202	9	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	2.53e-22	50	194	1	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.65e-22	50	194	1	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	3.69e-19	54	202	62	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	7.21e-17	55	200	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.98e-48	1	203	1	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	3.30e-28	5	202	11	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	6.33e-28	5	202	11	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	2.37e-27	5	202	11	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P75942	3.56e-22	55	194	152	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999142	0.000123	0.000011	0.000000	0.000000	0.000746

TMHMM  Annotations     

start	end
13	35