CAZyme Information: MGYG000003000_00138

Basic Information

• Species: Rothia aeria
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia aeria
• CAZyme ID: MGYG000003000_00138
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		34314.18	7.4179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003000	1497242	MAG	United States	North America

• Gene Location: Start: 11753; End: 12688 Strand: -

Full Sequence      

MLQFESRIPSVSVVIATNGKRMQSLRTAVTAILDQQYPGPVEVVIVYDRVTPDPLSDIEI
SENRSLRIIENTRTGGLAGARNSGILEATGIILGFCDDDDTWMPGKLTEQVALWRANPDA
VGISSGITVRSDGRNIVRLAPERATFDDFLRSRITEVHPSAMLYSRSDLVDGPVGLVDEQ
LPASYGEDYDLLLRATKHGDILSVPQPLVRVLWDRPSFFAGQWQYIADGLTYLLRKFPEF
ERYPKGVARVAGQVAFAHAALGHKKEAFAFARSSLHRDKTQLRAWAAYPVALGVVKPQTL
LDAVQKTGRGL

Enzyme Prediction     

No EC number prediction in MGYG000003000_00138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	169	4.9e-18	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	6.74e-18	12	169	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.72e-17	13	125	2	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	1.05e-13	12	210	1	192	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04195	GT2_AmsE_like	2.90e-10	12	211	1	200	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG1216	GT2	2.00e-09	9	275	3	297	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAV87443.1	2.79e-226	1	311	1	311
QQT89687.1	2.79e-226	1	311	1	311
QXW92877.1	1.14e-225	1	311	1	311
VEI22494.1	9.35e-225	1	311	1	311
QKI08771.1	6.72e-165	2	311	1	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5L3F2	5.33e-06	24	152	18	145	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD OS=Escherichia coli OX=562 GN=wfgD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003000_00138.