CAZyme Information: MGYG000003000_01111

Basic Information

• Species: Rothia aeria
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia aeria
• CAZyme ID: MGYG000003000_01111
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		45741.36	5.9672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003000	1497242	MAG	United States	North America

• Gene Location: Start: 3592; End: 4863 Strand: +

Full Sequence      

MESTHTSQAPTHTAADYAQRAADRARLAADSVLHQFAHRPLGVPGTLLGSVQVPETRPLS
KRLKDWHYWWQAHFLECVVDAGERELHAGNRLGASEWLSRARALVRGINARNLGTFVNGF
YDDMAWLALAAGRMNELSRAMNGGEGDTGAQDAGNVLFPQLRSGMSPYGGVSWSKQKRDF
INTPATAPTALAFARAGDVADASALVTWLNNTLWDAERSLYIDGVNVRTGKVRDVVGARD
IDLDYEQNIYTYNQGTALAALLAVAERSPEQAHSLVRRAEQLIVGIVTHLSEEFVFSDGQ
RGRVLASGGDGDGALFTGILVRYLAQAAQCELLSKDASLLAASLVHGSARAVWEGRREFD
PELPLSEPGVNTSEIRGDAVAVFSPKFTEQAHTVLPAGTPVELSGQLQAWMVLEASALLT
RVS

Enzyme Prediction     

No EC number prediction in MGYG000003000_01111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	56	358	3.4e-58	0.7486033519553073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	4.60e-44	39	423	17	374	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	5.03e-05	60	353	26	314	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW92059.1	1.89e-292	1	423	1	423
BAV86349.1	1.09e-291	1	423	1	423
VEI24323.1	1.09e-291	1	423	1	423
QQT88464.1	1.09e-291	1	423	1	423
ADP40692.1	1.75e-163	30	420	24	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	5.42e-22	64	419	84	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.14e-20	64	419	85	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	7.01e-20	64	419	85	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999462	0.000484	0.000061	0.000002	0.000001	0.000019

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003000_01111.