CAZyme Information: MGYG000003018_00659

Basic Information

• Species: Alistipes_A sp900549685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900549685
• CAZyme ID: MGYG000003018_00659
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		91924.27	4.8026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003018	2600623	MAG	China	Asia

• Gene Location: Start: 9053; End: 11551 Strand: -

Full Sequence      

MKKIDSFRFFVFMAGAAMFGGCSDRPADGCGEGALTQIPFEQVTLEDDFWYPRLCTQKHT
LVPFALEKTEPAVENLRRTAAFLRGEKGELPFPHPYVSSDLYKVMEGAAYLLAVEPDAEL
ERRMDEIIDIIAGAQQADGYLYESHITGVATTLEGPHYGGMGHRPYSMVIHSHELYDMGH
MYEAAVAYYQATGKRKWLDVAEKNARHIDRVFFEGDPAYNDGKPVNQAPGHEELELALVK
LFRATGDSLYLDMAGRFLDIRGVTFRPEGTGGWAPEYAQQHLPVREQREAVGHAVRAGYL
YSGMADVAAATGDSTFMPALDAIWHDIVDRKMHITGGLGAVPGIEGFGPAYELPNKDTYD
ETCAAVANVMFNYRMFLLTRDAKYVDVAEAALYNNVLAGVNLEGNRFFYVNPLEADGRKA
FNHGRRGRSPWFATACCPSNLARLIPQVPGMVWAQGDDEVYCSFYAGCSVTVPLTAGEVR
LTQRTEYPFEGDVSIGVDPAVDGEEFTLWLRIPTWCSGEGFVSGDLYRYADGLNPEAEVR
VNGRRVRSRARKGFVPVRRKWRSGDRVELSLPMPVRYNVADSRVEADSDRVCITRGPLVY
CAEAADNERPVSGYYIERVGQSGEVRRIVGGVLDGIPSVSVEAGISSSGSGRTASLTLVP
YYAWNNRGDGAMNIWFARSAATASGASPFAEGSIADVQASFTCMSDDVCAVADGKTPCDS
HDTSIPRWTSWPETGKAQTVELTLEESRPVESVSVYWYDDGRGVKLPVAWRMEYRSDGVW
HEFRPYVTDRFGVAADQFNMVHPAEEVEADALRLHLTPRSDAAVGILEIEVD

Enzyme Prediction     

No EC number prediction in MGYG000003018_00659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	43	601	6.4e-179	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.87e-152	42	601	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.47e-148	99	678	66	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	5.65e-06	147	368	50	272	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	2.79e-05	184	288	418	527	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG1331	YyaL	4.30e-04	175	351	467	641	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD19473.1	0.0	31	832	23	821
QJE94520.1	4.56e-298	32	832	24	819
BBO34810.1	2.99e-295	35	831	27	824
AIA99612.1	5.02e-294	32	832	29	827
QDU32639.1	2.96e-292	35	831	29	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.40e-162	35	675	7	622	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.09e-129	43	675	16	644	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.08e-123	43	675	16	644	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.32e-96	87	675	90	693	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WKW_A	8.07e-96	72	679	53	659	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.70e-95	72	675	53	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000007	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003018_00659.