CAZyme Information: MGYG000003054_01403

Basic Information

• Species: Eubacterium_R sp900547915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900547915
• CAZyme ID: MGYG000003054_01403
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000003054_254|CGC1	40960.94	8.8055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003054	1746475	MAG	Netherlands	Europe

• Gene Location: Start: 298; End: 1368 Strand: +

Full Sequence      

MLTSVYDGDTIIAETSEKVVKIPNFKSWSPESPFLYNVVFSCGKDRVKSYFGMRKFSVGK
DENGIPRLFLNNKPYFHNGLLDQGYYPDGFLTPPSNEAMEYDVKTVKKMGFNMLRKHIKI
EPLLWYHYCDVNGILVWQDMVNGGGKYGLEVSVLPFIGINLDDTNYKTFKRTDASQRESY
YKELREMLETLYNCPCIAMWVPFNEGWGQFDSAKAYKFIKEFDKTRVVDSTSGWHDRGVT
DVISKHIYFTPIKVKAGAKPYVLSEFGGFSHRVNGHTFNNKMFGYKIYNSPESLAKAYKK
TFENVIIPQISTGLSATVYTQLTDVEDELNGLLTYDRKVVKIPVDILKNINERVKF

Enzyme Prediction     

No EC number prediction in MGYG000003054_01403.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.39e-21	19	228	244	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.10e-09	68	338	8	285	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	2.53e-08	11	242	226	448	beta-D-glucuronidase; Provisional
PRK09525	lacZ	3.66e-07	3	243	259	500	beta-galactosidase.
pfam00703	Glyco_hydro_2	3.27e-05	8	54	55	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKW37630.1	1.13e-131	20	354	240	577
ACZ86262.1	5.07e-130	20	356	242	583
QYC40928.1	2.66e-127	20	354	235	567
AWB88178.1	5.07e-127	20	356	245	583
AXO33549.1	1.08e-126	20	355	240	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.49e-80	4	354	230	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6NCW_A	1.67e-09	1	276	197	479	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
6ED1_A	1.98e-09	16	277	255	525	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6U7I_A	2.93e-08	7	205	234	412	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
6D50_A	1.84e-07	28	205	271	426	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1SWB8	8.90e-13	14	243	286	498	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
Q03WL0	4.84e-09	22	244	291	495	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
Q04F24	6.21e-08	28	243	297	495	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
T2KM09	1.84e-06	11	233	249	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q75W54	7.36e-06	51	205	325	464	Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana OX=3702 GN=EBM PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003054_01403.