CAZyme Information: MGYG000003063_02014

Basic Information

• Species: Eisenbergiella sp900544445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900544445
• CAZyme ID: MGYG000003063_02014
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	MGYG000003063_46|CGC1	89909.58	4.8749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003063	3890464	MAG	United States	North America

• Gene Location: Start: 6508; End: 8916 Strand: -

Full Sequence      

MDSVRFLLNDNWKFHLGEAEDAWYKGYDDSSWEDVTLPHDWSVSLPFSREYSSGTGYLAG
GIGWYRLRFSLPEEYRGKKISICFDGIYKNSQIWCNSYYLGKRPNGYVPVTYDISSIACF
ENADGSGAENEISVKVTHTDLADSRWFTGSGITRKAYVLVEENIHPVPCGIFFSTLYGDD
GKSAQVEISHELINETDKNAGVAVTSSLISPSGKQVLQVSSCVDFEPGKSRTVVLNGCVK
NPLLWSPEFPTLYTLVTELSVNGQAPYRVYEGKVGIRTFRFDADEGFFLNGRSMKLKGVC
VHHDGGCLGAAMTPEIWERRLLSLKEMGCNAIRTSHNPHMPELYDLCDRLGFLMMGEAFD
EWENAKNKWSTGHNVYPPRHQGYFEDFPQWHEKDLAAMILRDRNHPSVILWSIGNEIDYP
NDPYCHPLFSEMTGNNDANKPAAERQYSPDKPNMERLAPIARHLAKIVRRYDTTRPVTLA
AAFPELSSRLHYFDALDVVGYNYKEHLYEEDHRRFPSLPILGSENGHGLKEWKAVTENDY
ISGQFLWTGIDYLGEAHGWPIHGSSAGLLTLAGFPKNRYYRRQSFWLDAPVLHLSTARYT
GDATEYLHASDCWNYEDGEQILVRCYTNLPSAELFVNGRSLGKQEGLNEEGSMDWIVPFE
AGELRVEGYPTGTAGEGDAEPVTFLLNTTGEPERLLLNRWAPPEMPASMTGYVEQIEILL
ADHDGNAAVHRDVPVTVSVSGPGVLLGLENGNLADNTSYSEPVRSTLDGRLIAYVRRTGA
GNVLVNVHAEGCEEASIQLPED

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	578	4e-114	0.5970744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.86e-71	1	557	8	507	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.99e-41	7	562	43	553	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	3.01e-31	8	479	15	447	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.11e-30	5	416	52	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	4.04e-24	8	159	4	166	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08200.1	0.0	1	787	3	792
CBL12712.1	0.0	1	787	8	797
VCV23256.1	0.0	1	787	3	792
QHQ63248.1	1.94e-313	1	799	1	787
BCJ99948.1	1.83e-311	1	799	1	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T9A_A	8.42e-162	8	799	32	841	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
5T98_A	2.12e-130	2	799	26	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	4.89e-130	5	799	3	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	9.71e-128	5	799	9	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
3GM8_A	1.97e-123	12	776	13	772	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.71e-151	8	799	47	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.14e-92	8	776	51	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	1.35e-46	2	758	25	753	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	7.55e-44	8	662	56	696	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.69e-42	8	747	8	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000004	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003063_02014.