CAZyme Information: MGYG000003090_00286

Basic Information

• Species: CAG-988 sp003149915
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-988; CAG-988 sp003149915
• CAZyme ID: MGYG000003090_00286
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	MGYG000003090_1|CGC2	65022.46	7.9235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003090	1480560	MAG	Spain	Europe

• Gene Location: Start: 283488; End: 285185 Strand: -

Full Sequence      

MMKKMKELWNETGTRIKKADIIIMIIMVLVYGIYSFINLGDMKAPQTFASFSEVSQSVTI
EVPNSTYITRMRVYTGNETGNFWIYLSEDGETYNYLNTLEANSVFSWQDVDINSNAKYVQ
LIAAEPNGSIGEVQLYDENSLPLEETATDDTSALLVDELDLVPIRISYMNSTYFDEVYFA
RTAYEYVHGLPAYEWVHPPLGKLIQAIPIALMGMTPFAWRMAGNICGILMIAVMYILGKK
LFKKRKWAITAALLMMLDTFHFAQSRMGTVDTELVLFSLLAVLFMVNYMQQKKNTKLWKR
LLNLFFSGLFAGCAIATKWTGLATGLILCIMFFYHLIKTNFGEGKKWTKDTTIIIICCFL
FFIGVPVAIYVGSYFLFPNFGVNTQVTNVQALLTQTEGIYNYHSTLTATHPYTSEWYTWP
IMWKPVWYYVAEYSDGLRETISGIGNPAIWWGACVAMLYVIYAAIRKRDKVALFIILGVA
VTWLPYLFIGRVMFLYHFFPTLPYMMFALVYVLKALSERFKTDKITMVFLFIVFVLFALF
LPIASGRAVDPSYVNYFRWLPQWYF

Enzyme Prediction     

No EC number prediction in MGYG000003090_00286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	164	376	3e-56	0.9372197309417041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	7.82e-25	399	561	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.20e-18	165	376	41	266	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	3.70e-17	406	565	515	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.36e-16	165	376	14	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	2.29e-12	197	562	136	434	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68061.1	5.58e-143	24	564	19	557
ADZ82369.1	1.62e-141	24	564	16	554
QUI22495.1	2.38e-114	6	565	392	969
BBF42044.1	2.12e-104	10	563	340	918
AIQ72362.1	3.24e-103	15	565	2	592

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	3.60e-23	174	563	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.21e-20	174	563	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.21e-20	174	563	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	1.91e-15	196	563	98	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q2LZ62	1.75e-08	174	375	223	437	Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998639	0.000798	0.000016	0.000004	0.000002	0.000565

TMHMM  Annotations     

start	end
21	40
216	238
274	291
311	333
353	375
443	465
472	489
493	515
527	549