CAZyme Information: MGYG000003094_01142

Basic Information

• Species: Phocaeicola barnesiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola barnesiae
• CAZyme ID: MGYG000003094_01142
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000003094_18|CGC2	44976.04	5.89

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003094	3093382	MAG	Spain	Europe

• Gene Location: Start: 16114; End: 17313 Strand: +

Full Sequence      

MMNKKIFSIFCLGVMGILPCVAQQALWGGSDIVSPELQEDGRVTFRIYAPEARTVEVQGD
FLATQLYETPFGKTAGPGRAALHKDENGLWTYTTDSLASELYCYTFRVDGLQVADPNNVF
QLRDVATISNYFIIGNGCGDIYKVQNVPHGTLIKEWYDSPTLGGEQRRMTIYLPAGYNKN
QDTYPVLYLLHGSGGDENAWSELGRLTQILDNLIAQGKARPMLVVMPNGNVSQSAAPGEA
SGPMVKPSLTESRRKNGEFERSFPDIVNYVEQHYRVIKEKHGRALAGLSMGGFHTLYISA
NYPDMFDYIGLFSAANTVEKESEMYQDLEGKLQTLFAGHPKLYWIGIGKEDFLYEKNKAL
RAMLDANQYPYTYYESEGGHIWKNWRIYLSRFLTELFVK

Enzyme Prediction     

No EC number prediction in MGYG000003094_01142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	159	395	1.3e-54	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.21e-37	143	397	60	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	2.22e-35	41	135	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	2.54e-22	159	386	1	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	3.33e-14	41	117	1	61	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG0627	FrmB	7.86e-14	161	394	29	306	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36651.1	2.67e-158	4	397	2	396
QIX64683.1	2.67e-158	5	397	2	396
QUR47977.1	2.67e-158	5	397	2	396
ABR44406.1	2.67e-158	5	397	2	396
QRO15451.1	2.67e-158	5	397	2	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	3.13e-99	32	397	22	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	9.99e-53	35	397	40	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	9.40e-49	35	397	19	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	1.58e-48	35	397	40	379	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	7.22e-43	35	397	42	381	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	1.29e-38	36	397	42	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	4.42e-33	35	399	329	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.01e-29	35	397	395	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	2.26e-28	143	393	41	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	1.24e-09	150	312	827	974	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004043	0.518885	0.476271	0.000272	0.000249	0.000258

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003094_01142.