CAZyme Information: MGYG000003125_01777

Basic Information

• Species: Corynebacterium kefirresidentii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium kefirresidentii
• CAZyme ID: MGYG000003125_01777
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		79353.12	4.8867

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003125	2294743	MAG	United States	North America

• Gene Location: Start: 25519; End: 27636 Strand: -

Full Sequence      

MNIPAADLARLNDCRHHDPHGFYGWHEGTVRTRQPGATAVQLHTPTQSLSMNLVGDDIWE
AEVGENCDYRLEISYPGAPTRTVADGYHFLPTIGSLDLHLIGEGRHERLWDVLGANLRSY
DTEMGPVSGVSFAVWAPNAQGVAVVGDFCGWNPTQYPMRSLGSTGVWEVFVPGIGAGEHY
KFAIFSQEGRKDKADPLAKRTACPPETDSIVDSTSFGWSDSAWMDKRTGNLDVPMSIYEV
HVGSWKVGANYNRLREELIPYLKEHGFTHVELLPVAEHPFGGSWGYQVSGYYSPSARWGS
PDEFRALVNALHENGIGIIVDWVPAHFPKDDWALGRFDGQALYEHPDPRRGEQADWGTYV
FDFGRNEVRNFLVANALYWAEEFHIDGLRVDAVASMLYLDYSRDEWLPNQFGGRENLEAV
QFLQETNATLNRTHPGVLTIAEESTSWPGVTAPTSENGLGFSLKWNMGWMNDTLEYFKHE
PIHRSYHHGELTFSMVYAYSERYVLPFSHDEVVHGKGSLWQRMPGDDWNKAAGLRALYGY
MFSHPGKNLLFMGQEFGQTTEWSEEHSVDWGNLDGWGNEWHRGIKRLVRDINLIYRDTPA
LWSQDFSQDGFQWVKADDSNNNVLGYVRYGADGSALLAVCNLSGSSIPDYGLWVPRDGAW
KMVLNTDDAVYEGAGNPLPQHIHVADNSATLHLPANSVQWYVLEQ

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	260	558	1.3e-159	0.9966777408637874
CBM48	114	202	5.3e-17	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	3	705	1	725	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	117	698	27	616	glycogen branching enzyme; Provisional
PRK12313	PRK12313	0.0	95	705	9	629	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	8	675	508	1187	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	89	701	2	626	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN47036.1	0.0	1	705	1	705
QQU81565.1	0.0	1	705	1	705
QQA99822.1	0.0	1	705	1	705
QRQ66739.1	0.0	1	704	1	704
QQU95100.1	0.0	1	701	1	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K1D_A	2.81e-304	6	700	8	718	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
1M7X_A	8.45e-212	100	704	1	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	9.29e-210	106	704	2	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
6JOY_A	4.10e-208	129	675	32	583	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
5GQZ_A	1.05e-206	3	674	25	737	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NR40	0.0	1	705	9	731	1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=glgB PE=3 SV=1
Q0SGR9	0.0	5	705	13	732	1,4-alpha-glucan branching enzyme GlgB OS=Rhodococcus jostii (strain RHA1) OX=101510 GN=glgB PE=3 SV=1
Q6NHR6	0.0	8	701	15	728	1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) OX=257309 GN=glgB PE=3 SV=1
Q8FQ12	0.0	3	704	11	730	1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) OX=196164 GN=glgB PE=3 SV=1
Q73X75	8.23e-313	6	700	17	727	1,4-alpha-glucan branching enzyme GlgB OS=Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) OX=262316 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003125_01777.