CAZyme Information: MGYG000003154_00513

Basic Information

• Species: UMGS1490 sp900548185
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900548185
• CAZyme ID: MGYG000003154_00513
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42786.81	9.942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003154	2438738	MAG	United States	North America

• Gene Location: Start: 63312; End: 64481 Strand: -

Full Sequence      

MPGRRENFDFPPPEDGKCDVLIIAGEHSGDEQAARMLEGALERNPDLRVCALGGRALKRR
GAQLLYDMTRHSVVGLVEVAKNYSHFKRLSAAVVRWIGEYRPRAVCFVDYPGFNLHVASE
LRKAGISVKGGGSVRLAYYISPQIWAWKARRRFKMAELLDSLAVIFPFEGKCYADTSLKA
EFVGHPFMSGRYSSKVFFDRSGPLLFLPGSRRIAVGKIFPAMLETLALLPGERAVVPYPS
GAVLEVLEGALERRPDLRGRVELVKISSEGRIGAKAVLMSSGTISLSACLEGIPGAIVYI
ANPLTYAIGRLLVSVKYLGIANILLDRPAWPEFIQGAAKPADIARRISECISRPDVVART
REDAKMLRLMLSAKNSRDASEWLLENASA

Enzyme Prediction     

No EC number prediction in MGYG000003154_00513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	20	369	3.1e-84	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.81e-77	20	385	4	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.12e-75	20	389	4	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.32e-63	20	352	1	340	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.01e-51	20	371	8	369	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.14e-45	65	375	42	339	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC65221.1	5.80e-134	1	384	1	379
QYM79894.1	8.19e-132	9	383	7	376
AHF91230.1	4.74e-130	8	386	10	400
ACB75370.1	4.79e-127	10	384	9	384
AKC82833.1	6.81e-126	8	384	9	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.26e-34	20	387	9	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.13e-34	20	387	9	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	1.20e-52	20	352	6	338	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	1.20e-52	20	352	6	338	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	1.20e-52	20	352	6	338	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9NCA7	1.68e-52	20	352	6	338	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
Q83DS5	1.68e-52	20	352	6	338	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003154_00513.