CAZyme Information: MGYG000003157_01114

Basic Information

• Species: Collinsella sp900556515
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900556515
• CAZyme ID: MGYG000003157_01114
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39768.74	5.4394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003157	1687971	MAG	United States	North America

• Gene Location: Start: 2611; End: 3672 Strand: -

Full Sequence      

MERILGVNLSGWFIPEPWVTPSLYAATGASNAAELQEAMGTAAYNERMRRHYETFVSEDD
FRRMAQIGLNAVRLPVPWYAFGSQESDASYISVVDYIDRAIEWAAKYDIRVLLDLATVPG
GQGDSNDSPTTPEAVAEWHSSTNGRHVALDVLERLADRYGEAESLLGIELLDTPQMSVRK
SLFTMTDGIPAHYLRNFYRDAYELVRSYMPEDKIVVFSSSGHPSEWKHFMRGAKYKNVYM
DLHLYHYRDEHALDITSPRGLTTAISRNKRELKEAISTGFPVLVGEWSGAAIFANSSVTP
EGRNAYERVFIANQLASFAPAAGWFFQTWKTEKRIAAWDARAALGTLERGMIE

Enzyme Prediction     

No EC number prediction in MGYG000003157_01114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	311	1.5e-60	0.8741721854304636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.60e-26	1	333	15	366	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	6.06e-05	53	289	22	238	Cellulase (glycosyl hydrolase family 5).
pfam02449	Glyco_hydro_42	0.005	58	167	13	131	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68982.1	6.67e-262	1	353	1	353
QIA34389.1	3.17e-260	1	353	1	353
ATP54675.1	5.26e-259	1	353	1	353
AEB06471.1	6.19e-187	2	352	3	353
QWT17456.1	1.25e-173	3	353	28	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.20e-41	3	287	2	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.97e-41	3	287	2	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	8.27e-30	4	332	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	2.33e-29	4	332	14	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	3.00e-29	4	332	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	5.29e-44	2	339	29	382	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	5.29e-44	2	339	29	382	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
A2RAR6	9.83e-42	2	344	40	397	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q12626	7.51e-39	2	345	47	415	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
Q5B5X8	3.19e-38	2	344	27	385	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003157_01114.