CAZyme Information: MGYG000003160_01111

Basic Information

• Species: UMGS1858 sp900555705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1858; UMGS1858 sp900555705
• CAZyme ID: MGYG000003160_01111
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		65306	5.3765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003160	1773026	MAG	United States	North America

• Gene Location: Start: 34; End: 1812 Strand: +

Full Sequence      

MCIRDSFSSTEYGGSTITQQLIKVMTQEDDHKIERKITEIMRAIYMERNCGYSKDDILEA
YLNVLPLSSNIEGVGAAANYYFGKDIKDLSLAQCAAIAGITQNPSRFNPYTHPENLRRRQ
ETVLFKMHQLGFITDDEYIQASNEELVFQNSARRVAVQDYYVDLLIEDIAADLMEQYGYS
YSYAIRMVYYGGLRIYSHEQPELQARVEAIYADDANFPTKIETDKQDPQGAIFIMDYEGH
TVATAGGRGEKTANRVNNRSTTSVRQPGSAMKPIAVYAPAISNNLVHFSSLVPDAPITLP
NGSKWPPNYGSSRPADRGLTTVTYALQRSFNTVPAQLLKQLTPERSYTFLTENLQMTTLV
SQDIDYAPLALGGLTYGVSCREMAAAYQVFGNGGYYHKPFTYERVTADGKTLLEDTYSPI
RALDENSAYVMNRLLQRVVRGGTAGSISGSWGSGWEVYAKTGTTGGSSRSGEYNVYFAGG
TPQYVAASWFGYDYDKSLSSRQTGYAMSLWNKAMLAIRDNNLENKQFTLKGTTEEHTFCS
ATGLLVGPENNCPSTLVGVYKPDNVPGNCTTHLKNPGTGDPAAGTPSTAAAE

Enzyme Prediction     

No EC number prediction in MGYG000003160_01111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	9	128	1.4e-41	0.6610169491525424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.26e-115	13	589	128	659	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.87e-115	13	514	53	525	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.54e-74	13	590	118	788	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	2.25e-62	13	521	109	565	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.42e-50	13	128	64	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34222.1	1.30e-131	10	569	145	700
BCI59848.1	2.34e-130	13	575	163	742
QNK41697.1	1.50e-123	5	569	147	704
QAT49292.1	2.88e-122	10	570	154	706
QNO19068.1	2.42e-119	9	569	150	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.61e-46	13	524	78	595	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	3.36e-43	13	492	87	566	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.14e-42	52	493	7	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	4.07e-42	13	527	89	769	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG7_B	5.44e-37	52	493	7	433	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	1.65e-57	8	514	126	640	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.65e-57	8	514	126	640	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	3.01e-57	8	514	126	640	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q97GR5	6.47e-57	13	514	148	663	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1
Q0SRL7	3.49e-56	6	544	139	691	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003160_01111.