CAZyme Information: MGYG000003162_01309

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D
• CAZyme ID: MGYG000003162_01309
• CAZy Family: GH5
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42881.89	4.276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003162	1479112	MAG	United States	North America

• Gene Location: Start: 92; End: 1246 Strand: +

Full Sequence      

MKAIKRIFAVMSAAALAAAMVSCGKDSSDGSSGKAVKKGEPAMRDITSMELVHEMKMGYN
LGNSLDVCNADRDGDGQVNESAEKVDETLWGNPTVTKEQLEFVKSSGFDSVRIPITWRDH
MDSEYKIDEEWMDRVQEVVDYACDLDMYVIINIHHDGGGDPDFGAWVRGASTDYDGVLAR
YKTVWEQICERFQDYGDKLIFESMNEVGFDDMNSADAYATLNNLNQSFVDLVRASGGNNP
QRHLLIAGYWTDIERTCVGGFEMPNDPANRSILSVHYYTPWEFCTTTNQYEWGSDAEVSL
MESKVEQLKTTYVDKGVPVIVGEYGTCYGNDEASRVAFCEKFVKLCTDAGIASYIWDDGG
LFIRSELKWQNEDMIAAIRKSAGV

Enzyme Prediction     

No EC number prediction in MGYG000003162_01309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	359	4.2e-99	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.37e-57	73	357	2	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.55e-25	38	380	33	381	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO05659.1	4.80e-172	5	381	5	386
CBK96026.1	1.79e-145	43	381	95	439
CBL35063.1	1.82e-143	43	381	140	484
CBL17363.1	3.22e-100	1	379	1	371
QQA02033.1	1.98e-90	42	359	39	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	7.34e-70	43	380	11	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6XSU_A	4.33e-69	42	372	7	341	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]
4IM4_A	7.58e-68	43	383	2	336	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6XRK_A	4.39e-67	47	372	23	361	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
3NDY_A	8.50e-66	43	383	7	342	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28621	3.21e-67	43	383	37	375	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	4.72e-64	29	384	41	387	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	1.21e-63	43	383	38	373	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P23660	1.47e-61	43	382	22	363	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P54937	2.12e-60	47	378	38	374	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000006	0.002013	0.998031	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003162_01309.