CAZyme Information: MGYG000003184_00300

Basic Information

• Species: Mixta calida
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Mixta; Mixta calida
• CAZyme ID: MGYG000003184_00300
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42580.72	7.6434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003184	4133670	MAG	United States	North America

• Gene Location: Start: 17555; End: 18703 Strand: -

Full Sequence      

MAARPLTIALVAGETSGDILGAGLIRALKAKHPDARFVGVAGPRMQAEGCESWYDMEELA
VMGIVEVLGRLRRLLKIRRDLTRRFTALKPDVFVGIDAPDFNITLEGRLKQRGIRTIHYV
SPSVWAWRQNRVFKIGRATNLVLAFLPFEKAFYDRYDVPCRFIGHTMADAMPLQPDKTAA
RRDLGIDEKALCLALLPGSRRAEVELLSADFLKTAMLLREKWPQLEIVVPLVNAQRREQF
EQIKAEVAPELPIHLLDGKGREAMIASDAALLASGTAALECMLAKCPMVVGYRMKPVTFW
LAERLVKTDYVSLPNLLAGRELVPELLQDDCQPERLAAALEPLLGAGETRARLLETFTEL
HQQIRWNADEQAAQAVLELANG

Enzyme Prediction     

No EC number prediction in MGYG000003184_00300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	365	7.1e-143	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	7	379	7	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	0.0	5	382	1	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.61e-180	5	382	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.94e-170	8	376	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.89e-45	10	343	231	569	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU44273.1	6.35e-277	1	382	1	382
AUY24288.1	1.28e-276	1	382	1	382
AIX74764.1	1.28e-276	1	382	1	382
AUX92467.1	2.44e-265	1	382	1	382
QHM76593.1	1.11e-261	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.82e-220	4	380	5	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.40e-220	4	380	5	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2VHX9	7.93e-242	1	379	1	379	Lipid-A-disaccharide synthase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=lpxB PE=3 SV=1
B6HZF6	4.01e-226	4	380	5	381	Lipid-A-disaccharide synthase OS=Escherichia coli (strain SE11) OX=409438 GN=lpxB PE=3 SV=1
B7LGP4	4.01e-226	4	380	5	381	Lipid-A-disaccharide synthase OS=Escherichia coli (strain 55989 / EAEC) OX=585055 GN=lpxB PE=3 SV=1
B7M1Y5	5.70e-226	4	380	5	381	Lipid-A-disaccharide synthase OS=Escherichia coli O8 (strain IAI1) OX=585034 GN=lpxB PE=3 SV=1
P10441	1.15e-225	4	380	5	381	Lipid-A-disaccharide synthase OS=Escherichia coli (strain K12) OX=83333 GN=lpxB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003184_00300.