CAZyme Information: MGYG000003184_01295

Basic Information

• Species: Mixta calida
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Mixta; Mixta calida
• CAZyme ID: MGYG000003184_01295
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		43764.03	7.5399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003184	4133670	MAG	United States	North America

• Gene Location: Start: 112056; End: 113237 Strand: -

Full Sequence      

MKLTRCAALLMMLSCPTLAAESPPSVDALPLSPPQTMPVSAWQTRVNEDRSITWRLYAPQ
ARKVSVVTGATPESYVSHSMEKAGNGIWSWRSAPLAPDLYEYFYNVDGLRIADPSSATPK
PQRQVNTSLILVPGSLLDVRQVPHGELHALSYHSRALNRERQLYVWTPPGMENSKAPLPV
VYFWHGFGDSGLSAVTQGRIPQIMDNLLAEKKIVPMLVVMPDTETDAAGLVPEDFIPAQR
RKDFYPRNADAADRELMQDIIPLILQRYHVREDAEGRALAGLSQGGYQALVSGMNHLQQF
GWLASFSGVTTETVPNQAVSAQLAQPQAVNRQLKNFTLAVGERDKVTGADIAGLKRQLEQ
QGIHFDYDPYPQLGHEMAVWRPAWIKFVQKLFR

Enzyme Prediction     

No EC number prediction in MGYG000003184_01295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	154	384	1.1e-43	0.947136563876652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	7.72e-68	80	393	3	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	1.41e-25	50	133	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd02858	E_set_Esterase_N	6.94e-14	50	118	1	64	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	4.59e-12	154	385	1	240	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	1.28e-11	143	386	7	253	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01057.1	2.89e-57	46	393	45	384
QDT66419.1	1.13e-56	1	393	1	382
QDT36837.1	1.40e-53	20	392	25	376
BCS41279.1	8.52e-53	49	393	43	374
ACB76502.1	3.38e-52	46	364	39	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	3.63e-34	52	393	48	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6NE9_A	4.56e-33	45	393	43	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6RZN_A	6.76e-33	49	393	30	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_A	1.14e-31	45	393	18	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.16e-31	45	393	18	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	7.58e-170	29	393	26	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	8.24e-36	45	393	330	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	7.86e-21	142	389	46	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	2.34e-20	46	393	397	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000506	0.996093	0.002662	0.000294	0.000221	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003184_01295.