CAZyme Information: MGYG000003208_00802

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_00802
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000003208_13|CGC1	56933.19	8.3279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 88770; End: 90323 Strand: +

Full Sequence      

MPATARFPALPYCFALILGLLALVGYWYGLGRPVVLPDVASASHKLQCASYTPFDKDQSP
FDQPFTLRPERMDADLALLATRFECIRTYSMTGLEGLPDLARKHGLKLMAGAWVSSDPLA
TEKEIDLLVASANANPDVVTSVIVGNEALLRKEVTAKQLVALIHKVKSQIRQPVTYADVW
EFWLQHPEIAPAVDFLTIHLLPYWEDDPSGIDQALKHVGDVRQTFGNKFAPKDVLIGETG
WPSEGRQRETAVPSRVNEAKFMRGFVAMAEANGWHYNLIEAFDQPWKRASEGAVGGYWGL
FDADRQDKGVLVGPVTNVPYWPLWLGIGGLILLGTLVLGGRVHSRRAALALPLLGAVAAC
SIGTWAELTRVTARFNDEWVWAGLLVALNLLVLAHAALALSAREGWRQRAFDWLEQRAGW
LVAFAGFAGAVMMLALVFDPRYRSFPSAALVLPALVYLVRPVTGPRREIALLTFIIGAGI
APQLFREGLLNQQAWGWAVVSGLMVAALWRCLRVRRG

Enzyme Prediction     

No EC number prediction in MGYG000003208_00802.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5309	Scw11	1.72e-51	64	305	47	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
pfam00332	Glyco_hydro_17	1.56e-07	75	308	29	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDF36726.1	0.0	1	517	1	517
QDH64346.1	0.0	1	516	1	516
QDG59542.1	0.0	1	516	1	516
SDV09837.1	0.0	1	516	1	516
QHD06149.1	0.0	1	516	1	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.54e-15	105	308	91	289	Crystalstructure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	9.18e-15	105	308	91	289	Active-sitemutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	1.52e-07	108	311	117	383	Crystalstructure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4B2W4	1.34e-17	56	308	38	296	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
Q5AMT2	1.34e-17	73	308	42	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
P43070	1.34e-17	73	308	42	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
Q2US39	3.55e-17	75	302	369	599	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
B8MXP5	3.55e-17	75	302	369	599	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999987	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
318	340
347	369
379	401
418	437
442	459
468	485
495	512