CAZyme Information: MGYG000003208_01063

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_01063
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154	MGYG000003208_14|CGC5	17242.79	9.8552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 173151; End: 173615 Strand: -

Full Sequence      

MRTVWITLFWLCLSGPALANCWQLAASRYHVDPLLLYAIAKVESGLNPMARNVNSDGSRD
IGLMQINSRHLPTLAQYGITEQHLISQPCTSVIVGAWILAGFIREKGYGWQAVGAYNAGT
GPQRDSRRAHYAAAVWRYYGQLLQQRQQLARQTP

Enzyme Prediction     

No EC number prediction in MGYG000003208_01063.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	22	147	3.9e-23	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	8.26e-57	1	139	1	139	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	3.47e-55	29	139	1	107	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.04e-25	22	136	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	7.60e-24	20	139	21	142	lytic transglycosylase; Provisional
cd16892	LT_VirB1-like	1.54e-14	31	140	9	143	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDG14559.1	3.86e-112	1	154	1	154
AZP70406.1	1.37e-87	1	154	1	154
SDV16526.1	1.37e-87	6	154	6	154
QKJ75664.1	1.37e-87	6	154	6	154
QVN01252.1	1.13e-86	6	154	6	154

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	8.89e-15	20	104	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.08e-39	1	142	1	142	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.08e-39	1	142	1	142	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	4.35e-39	1	142	1	142	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	9.59e-34	2	139	3	138	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	1.36e-33	19	139	18	138	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000580	0.998542	0.000309	0.000183	0.000171	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003208_01063.