CAZyme Information: MGYG000003236_00828

Basic Information

• Species: UMGS1397 sp900761355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1397; UMGS1397 sp900761355
• CAZyme ID: MGYG000003236_00828
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	MGYG000003236_39|CGC1	95045.07	5.2145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003236	2919488	MAG	United States	North America

• Gene Location: Start: 44897; End: 47410 Strand: -

Full Sequence      

MYIDLCSDDWSLEGYMPKCHRFNMEAGVGFSVGPILPKRRASVPGSVHDEMEKAGLVDPV
YYETNHLKCEWIENKCWAYERTVSLDPESRSRRIRLVCEGLNFEARIYWNGRLLGVHKNV
HTPAEFDLTGMAEAENTLTILLEEIPRADGQMGRSSTNRYQCERFAYGWDFCTALIGVGI
WKRVGLYVYDSCLLGDPAVLTDFEDGLGRIRIEGDGYPVDKALELDVCVKDGESVLYQGR
QAFTGGFAQTVTVQEPKLWYPNGYGAQPLYTVELALYDGGVLQDSRSYRVGIRRLEFVQN
EDSAPDALPYTVQINGKKIWLKAAVLLPIDQRLGHISDGDYDRYTAMLQNANVNMIRLWG
GGVSEKSRLFDRCDERGILVWQDFTQSNGGLDGVPSQEPEFLDELEKSAVYILKQNRSHT
CQTVYIAGNELRRDYSVNRRPVTADNPNVQMLHRLVQQYDPTRVFHPSSPSGPNFDILFD
EETRRLKRNHNVHGVWSYLGKAGHYEYYNKTDYLYQGEFGVNGASDEETLRRIFSEETLA
HYRCPDVHWQLRNSSWWDSFPRDAEVFGEENLATPEAFVAASQLVQAEGLRYTIERNRAR
AFQCSGNCIWQFNEPFPNPNCTNLVDFFGLPKMAYSWVQKAFAVTTPLLRYERLFYRPGE
TADFVLAVSHFGPCAPASVTVRLRTPQKVLAVREYEVALKENHCTPVDEWHLPVEESFGP
LFFLEVSVAVNGASAAKNLYSFGTDERAPYAPFFEGGSDLRLSCEYRAGAKRIRMANEGK
EPCYFVSALPAARQAGVLTENNFVTVFPGEEETVIVACKPDEPVSIKDFTRKIHQTI

Enzyme Prediction     

No EC number prediction in MGYG000003236_00828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	40	643	6.6e-67	0.5757978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.68e-40	42	618	33	607	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	5.51e-10	28	296	32	279	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	2.66e-08	196	293	5	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	4.68e-07	73	466	107	473	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	4.81e-07	36	140	28	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK57375.1	3.79e-181	1	818	1	828
QIZ10330.1	1.29e-180	1	820	1	826
AWV33833.1	1.10e-175	10	820	11	839
AIQ24052.1	6.10e-171	10	820	11	837
QTH41510.1	3.42e-166	3	820	4	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	7.04e-60	39	726	44	731	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.22e-53	41	834	28	841	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.24e-53	41	834	30	843	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.68e-53	41	827	30	834	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.06e-53	41	827	28	832	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	5.28e-52	42	640	31	651	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	7.01e-48	41	823	30	834	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	2.30e-47	43	827	32	841	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	3.09e-47	43	640	32	651	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	7.44e-47	43	640	32	651	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003236_00828.