CAZyme Information: MGYG000003268_00189

Basic Information

• Species: Prevotella sp900762125
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900762125
• CAZyme ID: MGYG000003268_00189
• CAZy Family: CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		29955.05	5.9431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003268	2466924	MAG	El Salvador	South America

• Gene Location: Start: 1147; End: 1923 Strand: -

Full Sequence      

MKQAFEISYRAPFGQSMHVCLKYIDVEQHERQADLLMHTEDGNLWTVETMGSVVSHTPVR
SIVYHYQLEDNDGKPLRSEFAGVPRFYVVDPTKNYHFCDIWRDLPLQTFLYPPAKRKVTE
IDTIPFFNESVLFRVSAPHVTDGQSVALLGSEPTLGAWSEKRYLLMRYVGNGDWMLSINA
YALHFPFEFKYVVVDDKSHDVIAWEKGTNRKVNIKELKANEQLVIYGGLVRTKCRLAYHD
EWLGGDFEADHEIQELYI

Enzyme Prediction     

No EC number prediction in MGYG000003268_00189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM20	131	216	7.1e-16	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05816	CBM20_DPE2_repeat2	3.75e-18	130	226	1	95	Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2. DPE2 is a transglucosidase that is essential for the cytosolic metabolism of maltose in plant leaves at night. Maltose is an intermediate on the pathway from starch to sucrose and DPE2 is thought to metabolize the maltose that is exported from the chloroplast. DPE2 has two N-terminal CBM20 domains as well as a C-terminal amylomaltase (4-alpha-glucanotransferase) catalytic domain. DPE1, the plastid version of this enzyme, has a transglucosidase domain that is similar to that of DPE2 but lacks the N-terminal CBM20 domains. Included in this group are PDE2-like proteins from Dictyostelium, Entamoeba, and Bacteroides. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
smart01065	CBM_2	6.64e-15	130	216	2	88	Starch binding domain.
pfam00686	CBM_20	1.67e-13	130	214	2	85	Starch binding domain.
cd05467	CBM20	2.78e-13	130	214	1	84	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
PLN02950	PLN02950	6.21e-13	5	214	13	236	4-alpha-glucanotransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29239.1	1.39e-103	1	258	1	260
ADE81398.1	9.24e-56	1	233	1	247
QVJ80744.1	2.41e-55	1	233	1	247
QNT66032.1	4.77e-41	1	247	1	250
QUT75082.1	2.79e-28	1	225	15	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RXD9	1.61e-12	4	232	22	265	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003268_00189.