CAZyme Information: MGYG000003282_00598

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_00598
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000003282_6|CGC2	70818.43	4.6331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 113479; End: 115452 Strand: +

Full Sequence      

MRKILFLAFQFLILHVSATTYYVSANGKSEGDGSKENPYNITTAVKKANPGDVIYLAEGT
YSLSETVKISRNGTASSPIKMQPEPGGRPVLDFSDQPRFDSNARGIQLSGDYWHITGLDI
IKAGDNGLYIDGGNHNTIEFCRFSENGDTGLQIGGGATYNLILNCDSYYNADKNMGNADG
FACKTSAGTGNIFRYCRAWMNSDDGYDGYLKDSDDITTTYEGCYAFMNGMLQDGTSAGDG
NGFKMGGCDADALRSHNAILKNCVAAKNKKNGFDRNSNIGSMTLYNCTSYANGGNDYIFV
AAKEKQQDLAEGKKITIKNCISVSNSTPSISCRADQVDMSHNTWDENLNCNTDDFVSLNV
NQYLADRDENGNLPDFTCLHLKSTSSLIDKGTVITGISYNGSAPDLGAYEYQPGDIDVDP
TDPLEDYTVNFSTIPGIFSAETIEGGATGTQHGITIGGTGSKSGSFIPSQAANAPGSSGA
ARLDGSGSYVQFPKQSKVKQVICYVAASGVNINSRSLSLQSSTDGINFSDVPGGLLEVTN
DATGKTICVDFDGTKDLFFRLISKSSGWNIYDFIVKPDNTTTGISETEVTDATNIHLTGN
ILYLPENESVTIYNISGKLCFQNKNTTTIDFSTQNRGYYIVRVKDMKGNIIISKIMY

Enzyme Prediction     

No EC number prediction in MGYG000003282_00598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	17	387	4.4e-117	0.9893333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	9.86e-10	105	288	2	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
TIGR04183	Por_Secre_tail	4.75e-06	600	656	13	70	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	1.19e-05	600	656	11	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
NF033708	T9SS_Cterm_ChiA	1.92e-05	608	657	2	55	T9SS sorting signal type C. The sorting signals of type IX secretion systems (T9SS) in the CFB bacteria are long, compared to other prokaryotic C-terminal sorting motif-containing signals, including LPXTG, PEP-CTERM, and GlyGly-TERM, and they seem to contain multiple motifs. A few T9SS substrates, including ChiA, have a variant form of T9SS sorting signal that may score poorly to both TIGR04183 (type A) and TIGR04131 (type B), depend on T9SS for secretion, but are released from the cell rather than left anchored to the cell surface.
cd14251	PL-6	7.52e-04	42	143	8	106	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APZ45418.1	1.02e-113	41	410	224	583
AUC19279.1	1.02e-113	41	410	224	583
QQY82139.1	2.10e-112	32	410	27	395
AOW17787.1	1.26e-109	38	410	216	578
APU68883.1	1.91e-108	16	411	232	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RU4_A	1.61e-74	21	410	17	398	ChainA, Pectate lyase [Dickeya chrysanthemi]
5OLQ_A	2.17e-33	20	375	4	407	Rhamnogalacturonanlyase [Bacteroides thetaiotaomicron],5OLQ_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLQ_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_B Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLR_C Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron],5OLS_A Rhamnogalacturonan lyase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1A6	1.60e-75	21	410	42	423	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1
P0C1A7	1.77e-73	21	410	42	423	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1
P22751	3.23e-24	18	299	388	646	Pectate disaccharide-lyase OS=Dickeya chrysanthemi OX=556 GN=pelX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.999022	0.000173	0.000154	0.000148	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003282_00598.