CAZyme Information: MGYG000003282_00690

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_00690
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1177		132102.08	7.2524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 49218; End: 52751 Strand: +

Full Sequence      

MKTKTLFLGMCLLMTSGVTAQQRSSSQIGENGWALWLDRDASWKNDSLYLPPTDISKITV
AGPTCGWDNLFSSLRPESEAKEVVKNKTLSLKVKVPGTVEEYYWDALSNNKGLGNTGDYK
GVSWWGTDFTVSREMKGKRIKIFFSEGIRQRAEVFVNRKLVGYELVHQTPFEIDVTDVIN
YGGSNELAVRITDPSGNFSWGDYTGDKWGDYLFPQSHGFGGILGIVELRSMSPLHVSDVF
VKNKPSLKDIDVEVEIINEAVRTLKGNVDIAIVEAWKGNAPVADPKILFTKNLGKVNVKT
GETTKLTFSASVPEARLWELKNSNLYNVVTTIKDSKGTVIDQHKQRFGFRFLSVEGYGKD
ATLYFNGKRTLLISSISWGYWPTNGMYPTRELARKHIESAFILGQNMLNFHRCQGNTQVL
DLADEMGMLYYEEPGGYSSSRVKEGSEQSKMKNRLLANQLNSQRFLRMVKRDRNHPSLVM
YNMINEPGWIPDERAKKDIADAHLLDPTRLVTYGSGFMNVGNDEPRKLHMIPYDQTQRTV
GYCDVHNAGNSAGVYVDAIYSSPESFLRNERAESEIFVWGEEAALASPPQLEKVVAAIEK
NGNRNGWDGADYKDWLNSYRSYIKNKGLEKYYPSITKLITSLGDIMYYEHGRFLENVRIA
DGADIYVFNGYEDMKNDNFSGAVDVFRNIKGTPELINHYAQPAFVAVKVREKIGHVGDTN
LFDMFVVNEHAVPAGDYSIKAWVVTPKGDTGILYDGTVKVSGGDTFSDLAAVKIPVKLNK
GIGYYKINAELVDRSGRKVASGYDDIFAVDWKSDKINGYGAVIGGGMELTNFLTDQKKAN
VVAYDESLGKLDYILVGSIDQGTAFNTISSFCFKAKDGKTMGLNLDYFRGKNFDMQVDRR
ISAAPIDFNVGSKLIPGYDILGDTKFSLRWEGYIVAPYSGETEFELSYDDGANLWFDGEQ
VVDNFKNGPKRVVTFKRNLIAGKSYPVKIEAYQDGGTWEFALKWKLPVKIQEPDMSALLK
RVRDDGTKLMLIDNAESWMSKLRAVGAVPGYKVFHPSKAWVGSSFMVREHPFFNELPVNR
GMNWEYQRLVVYDGPKHFGLYEMQGEEPVVSLVGSPFHQITTSVGVLPYGKGKIVFSSLD
LLPNLSLDSKPANVPKKILCNYLKWATDTPMNETYFK

Enzyme Prediction     

No EC number prediction in MGYG000003282_00690.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	86	675	4.7e-69	0.6156914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.67e-25	145	546	105	459	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.41e-23	116	513	110	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	4.98e-19	118	513	62	447	beta-D-glucuronidase; Provisional
smart00758	PA14	1.01e-16	882	1014	2	133	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
pfam07691	PA14	2.40e-16	882	1014	4	137	PA14 domain. This domain forms an insert in bacterial beta-glucosidases and is found in other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium prespore-cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68997.1	3.27e-232	1	1166	1	1128
QUT88121.1	8.15e-229	32	1166	34	1130
ALJ60861.1	2.28e-228	32	1166	34	1130
QRQ50392.1	7.35e-227	17	1166	7	1118
QUT46481.1	5.78e-226	17	1166	19	1130

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.58e-23	79	523	53	482	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7KGY_A	9.37e-20	90	523	46	460	ChainA, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_B Chain B, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_C Chain C, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_D Chain D, Beta-glucuronidase [Faecalibacterium prausnitzii]
6QUB_B	5.92e-19	121	514	65	459	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	6.09e-19	121	514	88	482	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]
5DMY_A	8.14e-19	121	514	94	488	Beta-galactosidase- construct 33-930 [Bifidobacterium bifidum],5DMY_B Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum],5DMY_C Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	8.59e-23	79	523	44	473	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	1.79e-19	118	509	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
B4S2K9	3.75e-18	127	516	126	488	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
P81650	6.47e-18	127	617	126	596	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
Q56307	2.99e-16	138	513	127	466	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000498	0.998543	0.000366	0.000221	0.000179	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003282_00690.