CAZyme Information: MGYG000003295_00741

Basic Information

• Species: CAG-312 sp002437405
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp002437405
• CAZyme ID: MGYG000003295_00741
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43031.23	8.4421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003295	2127186	MAG	Mongolia	Asia

• Gene Location: Start: 3529; End: 4701 Strand: -

Full Sequence      

MPPDVLKLREFSFAAPESGTCDILIVAGEHSGDEQAARMVSAALAVNPNLKICAFGGEKL
AQCGAQRLFDMTAFSVVGLVEVLKNYGFFSKLSEAVVDWIDRYRPKTVCFVDYPGFNLHL
AAMLKKRGISVKGGGSVKLYYYISPQIWAWKSGRRFKMAQLLDSLAVIFPFETKCYADTS
LDTHFVGHPFLSPDYTPPVEYSPDGKILMLSGSREIAVSRIFPVMCGALERLGGEKAVAV
YPTLRIKKILEDTLIKHPNLAGRVEIVPNDWSERMAAKAVMMSSGTMSLACSLAGIPGAI
VYKANPITYVVGRALVKIEYLSIANILLDKPAWREFIQFDASPEKLAKYMRECLAPTARG
QFETYADKLRELLHAPPKQTAADWLVGSLE

Enzyme Prediction     

No EC number prediction in MGYG000003295_00741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	23	363	2.8e-88	0.963276836158192

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	8.19e-81	23	383	4	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.15e-77	23	383	4	373	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.57e-65	23	376	1	361	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.76e-53	23	355	8	346	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.65e-50	68	385	42	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC65221.1	2.11e-134	9	389	6	382
AKC82833.1	1.54e-132	11	386	9	380
AHF91230.1	2.80e-129	11	389	10	401
AWI08977.1	5.35e-129	11	389	8	388
ACB75370.1	2.00e-126	18	389	14	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.10e-31	23	381	9	374	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.10e-31	23	381	9	374	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KC41	9.96e-56	23	347	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J161	9.96e-56	23	347	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q3JAC1	1.84e-55	23	390	8	379	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q83DS5	1.96e-55	23	347	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.96e-55	23	347	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003295_00741.