CAZyme Information: MGYG000003300_00103

Basic Information

• Species: Porphyromonas gingivalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas gingivalis
• CAZyme ID: MGYG000003300_00103
• CAZy Family: GT2
• CAZyme Description: N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		33675.78	9.3785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003300	1801215	MAG	Mongolia	Asia

• Gene Location: Start: 248; End: 1108 Strand: +

Full Sequence      

MKSACSIITASIVLYKSKPDIIRDVITSFFSDTVAKKKLILIDNSPTDSLRVLQEERPED
IQYFFNNRNIGFGSAHNIGIREAARFDPSYHLILNPDVQFGPEVVPTLASYMDENPDIGL
LMPQVYYPNGELQHLCKLFPRPWDVMLRRFVPYRSYRERNNERFELRNWSYDTIQDIPSL
SGCFMFARMDILRQVGGFDERFFMYAEDLDLCRRIGQVSRTVFFPKVSIMHTYAKGSYHD
AKLLRHHIVSLIRYFNKWGWFFDAERRRVNRACLTVLRKQSTVKKD

Enzyme Prediction     

No EC number prediction in MGYG000003300_00103.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	7.40e-40	8	266	5	259	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.75e-39	11	231	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	1.34e-16	10	217	1	188	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd06423	CESA_like	1.24e-06	19	208	9	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd00761	Glyco_tranf_GTA_type	9.63e-06	12	215	2	147	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUR48172.1	1.80e-214	1	286	1	286
BAK25230.1	1.80e-214	1	286	1	286
ATS03556.1	4.07e-211	1	286	1	286
ATR95398.1	4.07e-211	1	286	1	286
ATR96661.1	4.07e-211	1	286	1	286

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	2.50e-17	39	276	35	282	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	2.50e-17	39	276	35	282	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GU63	5.26e-08	12	214	24	205	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P36667	2.46e-07	38	254	30	243	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003300_00103.