CAZyme Information: MGYG000003300_00385

Basic Information

• Species: Porphyromonas gingivalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas gingivalis
• CAZyme ID: MGYG000003300_00385
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		42969.76	8.3054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003300	1801215	MAG	Mongolia	Asia

• Gene Location: Start: 2851; End: 4002 Strand: +

Full Sequence      

MRYFIVAGEASGDLHASNLVRALKEHDPEAVFAFMGGDFLSEATGEQPIFHYREVAFMGF
IPVLTHLGVIRRAGEHVQEQMRAFNPDVVIAVDYPGFNMRYVLPFVREELGKPIVYYISP
KVWAWKSWRIKTLKKYVDLMLCILPFEKDFFAGHDFPVIYVGNPCYDAVKQHMRPTIEEQ
ERSAKDSRQVALLCGSRLLEVKENLPVMLRVMKQFPDYRPVIAGAPGLTIQDYTPFLPDD
SIPVVFGRTYEILRESKAALVTSGTATLETALIGTPQVVCYYIRGGRLTNLIFKYCFGTP
FISLTNLIAGRAVVPELFGALFTEKRLAASLSPLLDASSAERQAQLSGYDSIRKSIGTDN
TSDKAARHIIARFAKDNVRPSSL

Enzyme Prediction     

No EC number prediction in MGYG000003300_00385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	9.7e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.62e-96	1	370	2	372	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.27e-95	1	371	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.38e-80	4	370	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.09e-69	1	371	1	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.85e-49	1	281	2	261	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIJ35071.1	1.15e-284	1	383	1	383
ATS06900.1	1.15e-284	1	383	1	383
AUR49588.1	1.15e-284	1	383	1	383
ATS04246.1	1.15e-284	1	383	1	383
BAG32725.1	1.15e-284	1	383	1	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.14e-42	5	370	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.14e-42	5	370	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.99e-66	2	370	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	5.19e-64	2	375	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	8.72e-62	2	375	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
A4XWS8	7.81e-57	1	376	5	377	Lipid-A-disaccharide synthase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=lpxB PE=3 SV=1
B3E4H8	6.98e-56	2	335	8	343	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003300_00385.