CAZyme Information: MGYG000003300_00743

Basic Information

• Species: Porphyromonas gingivalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas gingivalis
• CAZyme ID: MGYG000003300_00743
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
861		100547.97	5.8902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003300	1801215	MAG	Mongolia	Asia

• Gene Location: Start: 1762; End: 4347 Strand: +

Full Sequence      

MISKNTFRTFLLWLIPISITFQTQAAHTISADTLHLDKGWEFSRHDSTAWLPATVPGVVQ
YDLIRHGLLPDPNYRLQEEQAQWPEEHDWDYRLLFSLTEQQLRSPRAILMAEGLDTYATV
FLNGKKIMESRNMFVGREADITGLLRKSGNELLIRFRSPMKEVRPLRQRDGFDYPADNDH
HNEKLSVYTRKAPYHYGWDWGPRLVTTGVWRPVGIRFEGAVAFASKPEVTYTLTKDAQVN
CLFPLSWNEQNDRSVRLVVELYSPNGRKVHSEELTAGYGQPSCRTSFTVSSPDRWMPNGI
GLPLMYTLVARLQDKDGTTWQTYRTQIGFRTVEFVREEDTHGRSFFFRINGKPLYMKGAN
YIPGTMMLSARTEEYWQELFRSVSEANMNMLRVWGGGIYEDERFYELADANGILIWQDFA
FACTPYPGDEEFLRNVREEADYNIRRLREHPSLALWCGNNEIQEGLKYWGWQKRFDRSTY
QKFLTDYDKLFCRLLPERVAALDPTHAYVETSPDTANWGRPATLVWGDSHYWGVWYGREP
FGILRERIPRFMSEFGFESFPERKTLESFAWPEDMQLDSPVMKARQKSSVGNEIILEYMR
RDYPEPKDFDDFVFKSLIMQGQGMRIGLEAQRAAKPYCMGSLYWQLNDAWPTISWSGIDY
YGNWKPLHYQVRRAFEPVIIVPDAERRTISIVSDAPEAKGEDRMALRIEPISFEGKRYPT
FWVRNIEVDNEHPTVLPFPIEQWLPQELQRTNLLRLSLVEDVGEAYGEVWASTLYYHHSP
KDLLLPVAPPISQELRRTGLRTWELTVRSPYLVKDLFVETDALGARFSDNAFDLLPNEER
RLIITLPTDSTEDPVIRLRHL

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	696	2.7e-98	0.6502659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.28e-105	36	845	15	785	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	5.50e-13	229	330	8	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	2.13e-11	789	861	2	76	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	5.87e-09	91	461	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	3.64e-04	288	358	238	296	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATS02278.1	0.0	1	861	1	861
ATS06859.1	0.0	1	861	1	861
QUI91570.1	0.0	1	861	1	861
QUI89625.1	0.0	1	861	1	861
ATS08399.1	0.0	1	861	1	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	8.44e-275	30	861	5	834	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	9.04e-275	30	861	7	836	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	9.35e-275	30	861	7	836	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.48e-274	30	861	5	834	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.10e-272	30	861	5	834	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	8.83e-118	36	861	9	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	4.07e-113	36	845	9	828	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	4.07e-113	36	845	9	828	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1CGA8	8.12e-113	36	844	9	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	3.09e-112	36	844	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000398	0.998766	0.000236	0.000208	0.000189	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003300_00743.