CAZyme Information: MGYG000003346_01972

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_01972
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000003346_60|CGC1	50332.91	8.9352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 7265; End: 8614 Strand: +

Full Sequence      

MKHFSRYILLLCALFLVCMQGAAQDGKWREMHKVESKETIYGIAREYGLTVDELVKANPD
MAVPGYKLKKGDYIFIPYSKAEASGKAVQAAGKPASVAAPAGALKVGVLLPLHNVDGDGR
RMVEYYRGLLMACEDLKRQGHSVAVSAWNVPADADIYRTLVKDGVSRCDIIFGPLYSKQA
GPLSFFSKDNGIRLVIPFSITGDDVDKNPNIFQVYQSPETFYGMAADHFAYRFKDYNVVV
IDCNDKTSDKGVFTSSLRKRLGQKGVSCNITNISSGSGPFAMAFSAVKPNIVVLNTARSP
ELGTVLEMLDVLKGTHPELKISLFGYTEWLMYASHYLDRFCQYDTYIPTNFYYNSYSARV
SAFERRYQSEFGCDMMDYLPRFAMTGYDHGMFFIGGMLKQGKAFNGSVEYKDALQTPLRF
AKVRGGGYRNEMLMFVHYNRDKSISIIKF

Enzyme Prediction     

No EC number prediction in MGYG000003346_01972.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	3.56e-08	32	76	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG0683	LivK	1.48e-07	95	429	2	335	ABC-type branched-chain amino acid transport system, periplasmic component [Amino acid transport and metabolism].
cd06268	PBP1_ABC_transporter_LIVBP-like	4.42e-06	105	401	1	294	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.
smart00257	LysM	1.52e-05	32	69	2	43	Lysin motif.
pfam01476	LysM	8.49e-05	32	77	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB46898.1	1.64e-158	2	449	3	451
QVJ80666.1	4.45e-148	1	449	1	450
EFC70285.1	4.72e-146	23	449	22	454
ALO48876.1	7.75e-146	1	449	1	448
QYR10688.1	3.74e-139	1	449	1	450

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999149	0.000185	0.000137	0.000132	0.000129

TMHMM  Annotations     

start	end
7	24