CAZyme Information: MGYG000003359_00249

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_00249
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936	MGYG000003359_3|CGC2	102626.13	5.4463

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 69630; End: 72440 Strand: +

Full Sequence      

MSTRIESESVVSLTSQAVSIHEESVILLCASLFYFRIPPELWQERLEQVKEAGYNCIDVY
FPWNFHEPQEGTWDFTGMRDADTFLRLAGEAGLWVVARPGPYICSEWDGGALPSYLYAKE
PAMRIRDNDPAFLQHVARWYAQILPILGRHEVTRGGSVIFVQLDNELDFYDCSDPAGYMA
ALRDMASAHGISVPLIACAGQGGLRQASGLTQGIVPTCNFYPDDRDPQFESKVLHYREVL
REMEFPLLVTETNRSHYLLRRLLSAGAKLLGPYLQVSGTNFGFTNATNNWGKPLAFLTSD
YDFGGMISPEGHFREEAQEAKLLARLIRAYGRAIAEAVPDSGGSWSVEGETEGVFGPYVL
RLKGGGELIFVTNGEDRPKPIRLLRDQGTLARSSETCTLAASRSLALPANVPLSLWGMPG
HLVSSTAELYMAEQHKDGAVLAFHMEGDNGEIAFAIEPSHEPIAEEMRVVHREGQFILHL
TGAEKAFCRFELNDGRQFTVIVTSRLKALHVERINLDGTMTVSAFQPASNGPAPSPAPDW
RIETREGWRPPIQSLSVRTPGAKAEFLERLGVYRGYAWYEAKANRIDAGHQLQGFLVRQA
SDVVSLYEDGAYLGTRTPGGASVFIPAKGRGAERIQARVEIWGHSNFDDIRLPALRLPSL
KGMEGIAAITAIHDITANWRVNPDVGHSQTGVAAKGTNAADALWPVVGFGSWLSADHPSR
QLFRKAFVPGAGGNSWTLHFPKLQGHARLWVNGVDAGPIHPMNPFIDLTPYATPGQELQL
EVFLQRTIGQPAGQVLVYEGIEASEFSIAAAEEAQLKAEADHAAVSAASREFPLTLASGE
VGWLFAPINNSDQGKGWRVRAAGSGLKLTVFMDDRIVGRLWLPGGAGRPTMTGGSTDSFY
MPGPWFHDGQAQLSIFLEAVDEQAAGLLERLEFISV

Enzyme Prediction     

No EC number prediction in MGYG000003359_00249.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	20	323	2e-80	0.9804560260586319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.55e-69	23	325	7	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.69e-29	2	322	20	344	beta-galactosidase; Provisional
COG1874	GanA	1.39e-24	23	172	13	166	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	3.13e-14	38	178	8	146	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKU79215.1	0.0	1	936	1	934
AYQ71583.1	0.0	1	936	1	938
ALS29487.1	0.0	1	936	1	931
QKS44785.1	0.0	1	936	1	936
QTH41357.1	1.14e-316	11	934	8	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4E8C_A	2.11e-42	23	312	15	314	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	8.52e-40	28	311	35	325	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	6.31e-38	28	316	28	323	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	7.75e-38	28	316	52	347	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.03e-37	31	316	55	347	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VC60	2.05e-42	31	311	48	335	Beta-galactosidase-1-like protein OS=Mus musculus OX=10090 GN=Glb1l PE=1 SV=1
Q95LV1	4.20e-41	31	311	52	339	Beta-galactosidase-1-like protein OS=Macaca fascicularis OX=9541 GN=GLB1L PE=2 SV=1
Q6UWU2	1.39e-39	31	311	52	339	Beta-galactosidase-1-like protein OS=Homo sapiens OX=9606 GN=GLB1L PE=2 SV=1
P23780	5.57e-39	28	311	52	342	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q8IW92	6.66e-39	31	313	67	354	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_00249.