CAZyme Information: MGYG000003367_01108

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_01108
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000003367_27|CGC2	45154.32	6.7552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 41360; End: 42538 Strand: +

Full Sequence      

MRILLFISCFLTLASCSRQETMKELTDRVFTVAEQQYACMDTLLTDKTLPRTVLSGGKFV
PSNIYWWCSGFYPGSLWYIYEYTGNEHIRALAQKNTLKLDSVQYITRDHDVGFQLNCSYG
NAFRLTGDEAYKKVLYQGAKSLSTRFSTKTGVIRSWDFVRKGCDWKYPVIIDNMMNLELL
LSMSKAYDDDSLQYIACTHANTTIRNHFRDDYSTYHLVDYDPETGKVRHKQTVQGYSDES
SWSRGQAWALYSYTMMFRITGYQNYLLQAGHIADMLIRRLPADGIPYWDFDAPDIPNALR
DASAAAIMASAFIELSHYIQRVEAKEAYLDMAEKQLRTLASKEYLAEPGTNGNFILKHSV
GSFPDKSEVDVPLTYADYYFLEALLRYKNLLK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	63	387	6.1e-128	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.46e-10	59	391	21	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40061.1	1.75e-245	1	392	1	393
QUT26394.1	2.04e-244	1	392	1	393
SCV07260.1	1.67e-243	1	392	1	393
QRQ54741.1	1.67e-243	1	392	1	393
ALJ47855.1	1.67e-243	1	392	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.27e-109	50	392	56	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.69e-50	17	387	20	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.73e-50	17	387	21	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	2.42e-50	17	387	21	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	9.29e-50	17	387	21	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	7.57e-96	67	391	77	398	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	9.48e-50	17	387	21	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	9.50e-47	50	386	25	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	1.46e-46	67	387	67	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	3.04e-46	67	387	70	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000159	0.115610	0.884135	0.000047	0.000053	0.000041

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_01108.