CAZyme Information: MGYG000003387_03920

Basic Information

• Species: Pseudomonas_R sp900766265
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_R; Pseudomonas_R sp900766265
• CAZyme ID: MGYG000003387_03920
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		33404.98	4.9818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003387	4465621	MAG	United States	North America

• Gene Location: Start: 189374; End: 190285 Strand: -

Full Sequence      

MIRQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFCRTDLVPPVEIAARAENVGET
TMSTTLVNGEVKVDTVEHLLSAMAGLGIDNAYVELSAPEVPIMDGSAGPFVFLIQSAGLQ
EQDAHKKFIRIKREVTVEDGDKRATFLPFEGFKVSFEIDFDHPVFHGRTQTASVDFSSTS
FVKEVSRARTFGFMRDIEFLRSHNLALGGSVENAIVVDENGVLNEDGLRYEDEFVKHKIL
DAIGDLYLLGNSLIGEFRGFKSGHALNNRLLRTLMSQEDAWEVVTFDDPQTAPISYMRPV
AAG

Enzyme Prediction     

EC	3.5.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	275	4.6e-117	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13186	lpxC	0.0	1	298	1	295	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	7.86e-179	1	301	1	300	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
pfam03331	LpxC	9.84e-179	4	276	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
TIGR00325	lpxC	1.16e-135	2	300	1	297	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	5.33e-96	1	274	2	298	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCY01206.1	2.42e-207	1	303	1	303
AWL00601.1	2.42e-207	1	303	1	303
AVX12214.1	2.42e-207	1	303	1	303
AWT11194.1	2.42e-207	1	303	1	303
AKN26000.1	2.42e-207	1	303	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7K99_A	3.94e-196	1	302	1	302	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
5UPG_A	4.08e-196	1	302	2	303	Crystalstructure of LpxC from Pseudomonas aeruginosa in complex with PF-5081090 [Pseudomonas aeruginosa PAO1],6C9C_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with racemic ligand PT803 [Pseudomonas aeruginosa UCBPP-PA14],6CAX_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT805 [Pseudomonas aeruginosa],6DUI_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT801 [Pseudomonas aeruginosa LESB58],6E54_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with ligand PT802 [Pseudomonas aeruginosa PAO1]
5U3B_A	5.63e-195	1	299	1	299	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
5VWM_A	1.34e-194	1	302	98	399	Crystalstructure of UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (LpxC) from Pseudomonas aeruginosa in complex with CHIR-090 inhibitor [Pseudomonas aeruginosa PAO1]
5N8C_A	1.36e-194	1	302	2	303	Crystalstructure of Pseudomonas aeruginosa LpxC complexed with inhibitor [Pseudomonas aeruginosa],5N8C_B Crystal structure of Pseudomonas aeruginosa LpxC complexed with inhibitor [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7UZI4	2.16e-195	1	302	1	302	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=lpxC PE=3 SV=1
P47205	2.16e-195	1	302	1	302	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lpxC PE=1 SV=2
Q02H34	6.18e-195	1	302	1	302	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=lpxC PE=3 SV=1
A6VB79	1.25e-194	1	302	1	302	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=lpxC PE=3 SV=1
Q4K6J9	1.77e-194	1	302	1	302	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003387_03920.