CAZyme Information: MGYG000003389_01751

Basic Information

• Lineage: Bacteria; Bdellovibrionota; Bdellovibrionia_A; CAIPTA01; CAIPTA01
• CAZyme ID: MGYG000003389_01751
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		27961.44	7.4152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003389	3878302	MAG	United States	North America

• Gene Location: Start: 5; End: 751 Strand: +

Full Sequence      

MNLNFHPLCDIHTRAANPVIGKRAFGSDDELVSKMASAMVRGFVANRVIACAKHFPGHGD
TVVDSHVELPKLDVSWEKLKDRELKPFVRVIKSRVDMIMTAHILNQALDPIYPATLSYST
ITNGLRKDLRYSKLVITDDMTMDAVDKNFGEDRIVLAINAGCDLLLYRNEERGRAAMDVA
FKFLAEGRIQPEQVEAAFARIKEVKDRVLTPYQPVVMEELSKVIGCEAHQEVLRMVREKR
KPGGEMPE

Enzyme Prediction     

No EC number prediction in MGYG000003389_01751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	166	5.2e-45	0.7083333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.92e-52	2	228	115	337	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.02e-43	2	204	120	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	3.40e-28	3	173	117	285	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.27e-07	1	164	151	317	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA55401.1	1.63e-63	1	233	122	356
QLY25359.1	1.78e-61	1	248	121	370
QDK47175.1	2.51e-61	1	248	121	370
CUQ66071.1	2.33e-60	1	238	118	357
ASD65246.1	2.80e-60	1	248	121	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.20e-42	1	207	130	339	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3TEV_A	1.44e-36	1	211	126	341	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3WO8_A	5.62e-35	1	203	119	322	Crystalstructure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]
3BMX_A	5.81e-35	1	239	169	433	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.48e-34	1	239	143	407	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	2.69e-35	1	230	156	403	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P40406	3.18e-34	1	239	169	433	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
C4LEY6	1.51e-27	1	177	111	286	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q5QUZ5	1.43e-26	1	173	113	282	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
Q0A911	5.01e-24	1	169	117	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000011	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003389_01751.