CAZyme Information: MGYG000003391_00305

Basic Information

• Species: Gemella sp900766305
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sp900766305
• CAZyme ID: MGYG000003391_00305
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000003391_20|CGC1	40666.93	8.3488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003391	2000366	MAG	United States	North America

• Gene Location: Start: 4472; End: 5554 Strand: -

Full Sequence      

MKKILFTGGGSAGHVSVNVALIPEFKKNGYEISYIGSKTGIENEMIGKISGVKYFKISSG
KLRRYFSWENFIDPFKVLKGILDSLLILKKEKPNFVFSKGGFVSVPVCVAAKLLRIPVVL
HESDLTPGLANKINIKFCNHIFTTFEDTQKFLPKGKASLIGAIVRDDIYTGDRQRAYELT
GFNEDRPVLLVMGGSLGSKILNDYIWNNIDQLTEKYQIVHLVGKGLINNNIDKEGYKQFE
FLSKELFDVLKITDFVISRAGANSIYEFLALELPPILVPLGTNQSRGDQIENARFFEKNG
FAKVVVEEDFATLPISQIDEFYNNLEDYKHSMQVYKNEKRVINDVNDFYNKILDKVGGEI

Enzyme Prediction     

No EC number prediction in MGYG000003391_00305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	334	5.7e-32	0.9299363057324841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	1.28e-129	1	347	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	1.37e-127	1	329	1	329	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.34e-102	3	329	1	329	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.51e-94	2	329	1	329	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.09e-85	2	339	1	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI38955.1	1.24e-256	1	359	1	359
QIX87633.1	5.17e-233	1	359	1	359
AME09790.1	3.13e-211	1	357	1	357
AXI27390.1	3.13e-211	1	357	1	357
SQH55084.1	2.99e-209	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.07e-29	3	308	4	307	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	6.35e-25	2	318	10	329	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	2.23e-24	2	356	7	350	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49XM9	2.01e-139	1	344	1	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=murG PE=3 SV=1
B9DNZ7	1.32e-138	1	335	1	337	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=murG PE=3 SV=1
Q2YY01	4.41e-133	1	331	1	340	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=murG PE=3 SV=1
Q4L6C8	8.57e-133	1	353	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=murG PE=3 SV=1
Q2FYL5	1.78e-132	1	331	1	340	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003391_00305.