CAZyme Information: MGYG000003397.1_00757

Basic Information

• Species: F0422 sp900766245
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp900766245
• CAZyme ID: MGYG000003397.1_00757
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475		54173.8	9.4888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003397.1	1814704	MAG	United States	North America

• Gene Location: Start: 139129; End: 140556 Strand: +

Full Sequence      

MKHLQFMKHMVLGISTLSLFASYQVAEATIHIPFPALSNTTTAVAPTQYVGPMLHVPEKQ
EVTLPITMVFDPIVSETAYDTKYVQNGTSIISPSWFELTTSGLKVSPKLSHDYVNSYKEK
GYRVWPLITNQFDPDMTSKILANESMWERYKQGLINYATEYGYDGYNFDFENVHYKDKAQ
LTKFVDFLAKGLRTYNIHSSIDVTGYSNSENWSLVYDRKAYADAVDYVVLMAYDETWASS
VTAGPVASYPWVRKHTEQMLSEVPASKLVLGIPFYMREWSVPVKGSWEGKAKSKTLAMTK
ALDLEREYRDALRWDDRLKGNYLTLTNKNGVYGIYDEKKPYEGTLTKIWFEDPQSLSYKV
GLVKEFQLAGVAAWRKGFEASDVWPVLSFALDSATTNSTEKGKADSDKKDHKKEVKKQEK
KKDKKKKSKHIDTSEVTKISKDGKEVVLKFKKPHKQSDETGIVKVTKEKKSLPKD

Enzyme Prediction     

No EC number prediction in MGYG000003397.1_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	113	381	8.3e-36	0.7837837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.27e-69	91	387	29	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	9.31e-45	112	388	151	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	6.32e-22	89	384	25	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	2.54e-18	138	374	80	302	Glycosyl hydrolases family 18.
cd02875	GH18_chitobiase	2.77e-18	95	374	53	334	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV65543.1	4.82e-116	56	379	121	426
BBU34423.1	4.92e-116	65	379	130	426
BBU36194.1	1.28e-115	65	379	130	426
VEG93546.1	2.76e-115	65	379	130	426
CAB1275696.1	2.19e-114	65	379	130	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q6T_A	2.19e-22	99	394	36	342	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3J_A	3.91e-22	127	387	172	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	7.28e-22	91	384	138	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	1.14e-19	123	375	66	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4WIW_A	4.84e-17	91	388	37	345	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	2.14e-26	118	387	81	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	4.67e-22	127	387	171	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	5.11e-21	127	387	171	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	1.00e-19	96	388	139	420	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O31682	1.04e-19	89	298	27	224	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000778	0.998177	0.000306	0.000254	0.000230	0.000202

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003397.1_00757.