CAZyme Information: MGYG000003397.1_01222

Basic Information

• Species: F0422 sp900766245
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp900766245
• CAZyme ID: MGYG000003397.1_01222
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000003397.1_27|CGC1	60568.18	9.5898

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003397.1	1814704	MAG	United States	North America

• Gene Location: Start: 65438; End: 67039 Strand: +

Full Sequence      

MKLHRVTYVVFLFFLGVYVLGNHLLPVSDPVESNYALTAKEMVLSGDWLSPQIYGHYWFD
KPIMIYWLLSLSYSVFGMTDFAARFPSALFGALSVAMVYQGVRTLTGQRVGALLAAFILG
TSLIVWTIAHGIITDMVLLFATVGTFYYAYRGLLVKNPWHMAVAYGFAGIAVLTKGPVGL
VLPGLLFLIYAGVKRSWSMVKALFPWQGILILLAIVLPWYGYMYHTHGMEFINGFLGLHN
ITRATQSEHPEVNHWWYYLPIFLGGSLPWTGAILYGMYRGWKTRSDAYVYTMITGWGTIL
FYTVMATKYPTYAFISVIPFSLLGAYGVISLKDASHRAWWWLLGPTLVLWWALGIGTFFA
PWGFWWILRAFVVGLTIFLTGCYWYGKRLMMPFTVGMGTLVVLGIVLMEGLVPFLGLRSS
VTYHEQIRSFHGSVYYYGEYAASVPYYLDITPVRVEPSPERLAKYNVQRSAKWNGKNVMP
QIEEQELFKRLQSGERMLIITNKNYGKELEESSVGQYLERDTSSSKVVLLHSK

Enzyme Prediction     

No EC number prediction in MGYG000003397.1_01222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	479	1.5e-96	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.14e-48	1	365	4	375	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.55e-37	1	336	2	341	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.51e-20	60	219	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.19e-13	10	224	5	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.24e-05	64	328	68	372	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQB17174.1	1.09e-188	1	533	1	539
SNV02078.1	1.09e-188	1	533	1	539
ACZ25367.1	1.09e-188	1	533	1	539
BBU37212.1	9.79e-187	1	533	1	539
CAB1277318.1	4.08e-186	1	533	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.00e-31	30	339	57	372	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TBG8	4.74e-31	8	329	8	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
A9MJC5	1.07e-28	8	329	8	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=arnT PE=3 SV=1
A0KGY4	1.44e-28	12	338	10	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A1JPM4	3.70e-28	12	336	14	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
Q57M54	4.75e-28	8	329	7	330	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=arnT PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000013	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
81	103
110	132
167	189
202	224
254	276
288	305
309	331
338	360
364	386
393	415