CAZyme Information: MGYG000003401_01317

Basic Information

• Species: Staphylococcus capitis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus capitis
• CAZyme ID: MGYG000003401_01317
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000003401_25|CGC3	36014.25	10.2069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003401	2394594	MAG	United States	North America

• Gene Location: Start: 290492; End: 291502 Strand: +

Full Sequence      

MQKKYITALIGTTAISALATTQAHAATTHTVKSGESVWSISHKYGISIAKLKSLNGLTSN
LIFPNQVLKVSGSSSSASKSKTSSNSGSVYTVKAGDSLSSIAAKYGTTYKNIMKLNGLNN
FLIVPGQKLKVSGSVSTSKSTSGSKKATSSSSGRTSTYTVQYGDSLSLIASKYGTSYQKI
MQLNGLSNFFIYPGQKLKVPGGGSGGSSSSSTSKSTSSGGYYTPVFYHQNLYTWGQCTWH
VFNRRSEIGKGISTYWWNANNWDNAAAADGYTIDYNPTVGSIAQTDAGYYGHVAFVERVN
SDGSILVSEMNWSAAPGYMTYRTIPSYQVRNYKFIH

Enzyme Prediction     

No EC number prediction in MGYG000003401_01317.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	90	131	1.5e-17	0.95
CBM50	158	200	2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	2.70e-34	221	336	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	4.09e-22	31	199	335	523	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	3.26e-21	31	199	410	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	1.52e-18	232	325	508	606	amidase domain-containing protein.
pfam01476	LysM	1.01e-13	90	130	1	41	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL93276.1	1.28e-214	1	336	1	336
QOX61610.1	1.28e-214	1	336	1	336
BAW91733.1	1.28e-214	1	336	1	336
QKH91955.1	2.12e-210	1	336	1	333
ATN03628.1	3.07e-206	1	336	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	2.34e-31	230	336	50	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	3.99e-30	230	336	9	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	2.54e-16	232	324	248	345	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	7.20e-09	90	131	5	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	4.34e-07	90	131	5	46	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMN2	3.37e-185	1	336	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	3.37e-185	1	336	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q6GJK9	1.97e-163	1	336	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q6GC24	2.79e-163	1	336	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q5HIL2	2.79e-163	1	336	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999005	0.000168	0.000209	0.000181	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003401_01317.