CAZyme Information: MGYG000003422_01318

Basic Information

• Species: UBA1712 sp900766815
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA1712; UBA1712 sp900766815
• CAZyme ID: MGYG000003422_01318
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000003422_80|CGC1	35997.43	4.3111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003422	1683805	MAG	Fiji	Oceania

• Gene Location: Start: 12256; End: 13194 Strand: +

Full Sequence      

MQNTVNVNATPEARELLNMLSETAGKAVITGQHTQTIPMEEIDYIRSVTGREPKLRGFEL
LAYSPNINYEDADEACLTEVYENRGTVETAIEWAKNSDGIVTLSFHWFSPIGGRDKSFYA
KNTDFDAERILIERTPERAAFYHDMDVIAIELRKFEKENIPVLWRPFHEAYGDWFWWGAK
GPCVAAELYKLMFDYYTNELHINNLIWVWNCPIKEAYPGDDCVDVVSVDVYPEQFEKTDY
RSQYEELVAGTSKDKVAALAEVGYLPDISMLEESHVPWAYYMTWSKEFCIGEQYNSKESL
KAMYGSDYAVTM

Enzyme Prediction     

No EC number prediction in MGYG000003422_01318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	311	5.1e-95	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.81e-42	5	311	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	6.09e-09	145	264	164	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	5.48e-165	1	311	1	311
QNM01251.1	1.92e-163	4	312	8	334
AEB13973.1	5.45e-162	1	312	1	310
AOZ93051.1	1.67e-126	6	312	11	317
AZK45707.1	2.47e-125	6	312	8	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	5.50e-60	3	312	144	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.18e-56	5	311	7	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	2.09e-45	13	312	43	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	3.95e-37	5	311	24	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	1.67e-31	9	284	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.91e-58	6	312	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	5.61e-50	5	312	29	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.15e-49	9	288	151	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	3.36e-46	5	312	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	1.96e-41	5	312	158	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003422_01318.