CAZyme Information: MGYG000003429_01289

Basic Information

• Species: CAG-873 sp004552725
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp004552725
• CAZyme ID: MGYG000003429_01289
• CAZy Family: GH20
• CAZyme Description: N,N'-diacetylchitobiase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39904.13	5.1792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003429	1944366	MAG	Fiji	Oceania

• Gene Location: Start: 41; End: 1111 Strand: +

Full Sequence      

MERRYRLTGDDYYRLIDPQDTSRYVSAQWFGDNVMNPALPGPVRFMTDVTARIKAMYDEA
GVEMPAMHIGGDEVAMGAWTGSPIANAYMTERGITNYRDLHYIFVKELTANFAAMGVKVS
GWQEISMRSEESFNELVRPNTFSINCWRNPDDNSAIIAQTAMADYPTVLSIVNHFYLDMC
YSSHPCERGLTWGGTVDEFDALHGYPYQLCPVDSAHFANVLGISGHLFAETIRSGRMIEA
YLLPKMLGMAERAWNAQPTYTDADFNAVIVKREMPFWLANGSPIHLRQPGIVIADGHVVM
NTSYPDVEVRYTLDGTEPTSTSPLYSAPFAVGDAHQVRAAIYWHGSRSVTSVLYVK

Enzyme Prediction     

No EC number prediction in MGYG000003429_01289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	25	256	3.8e-34	0.6231454005934718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	8.24e-69	1	258	130	419	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	7.89e-35	12	257	119	345	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	8.90e-33	14	353	382	713	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00728	Glyco_hydro_20	1.56e-30	17	256	118	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
cd06570	GH20_chitobiase-like_1	3.76e-17	32	257	121	299	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10820.1	6.00e-106	1	354	397	746
VTZ55501.1	1.53e-83	13	356	441	819
QBJ17558.1	1.98e-83	13	356	456	834
QUT34090.1	1.98e-83	13	356	456	834
BBK89309.1	3.00e-83	13	356	441	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EZR_A	4.39e-27	15	254	385	608	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	4.86e-26	15	254	382	605	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]
1QBA_A	4.49e-22	13	339	452	844	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	1.17e-20	13	339	452	844	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	5.12e-20	13	339	452	844	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	2.40e-28	1	315	440	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	1.48e-27	13	315	476	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
P49007	4.90e-23	13	255	471	727	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
Q54468	3.35e-21	13	339	479	871	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P96155	3.91e-20	15	250	382	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003429_01289.