CAZyme Information: MGYG000003445_01027

Basic Information

• Species: RC9 sp900767375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767375
• CAZyme ID: MGYG000003445_01027
• CAZy Family: CE6
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		42239.67	6.3565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003445	1789928	MAG	Fiji	Oceania

• Gene Location: Start: 18446; End: 19606 Strand: -

Full Sequence      

MKRIILTALVVLMTLTAGARDKNFHIFICIGQSNSEGNARPEQIDKENVPSNFKMMAAVD
FMDMGRKTGKWYPAVPPLCRQDTGLTPGDWFGRTMAENLPKGHSVGIINVSVAGCKIEAF
MKDEAEAYAATGADWLQNIMKIYDNNPYNYVLALAKKAQKDGVISGILLHQGESNPNDEE
WCNKVKSIYDMLLKDLKLKAEDCPLLVGETVNGDRGGVCAGMNEYIGRIPSVIPTGYVIS
SSGCKENFDRLHFSAEGYRTLGRRYAAKMLSLMGIEIAPEEAKEPESPVVHAMPRFPGMP
AAPAGMPRMKQNVTFNISAPAAKEVFLVAQFADERIPMVKNSAGVWSATVQPEAAGAYYY
EVDGKKFVDPGNPKTMTVSVLELPAE

Enzyme Prediction     

No EC number prediction in MGYG000003445_01027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	87	196	2e-29	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	9.50e-34	23	271	1	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
cd11294	E_set_Esterase_like_N	3.51e-17	313	375	3	69	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd02858	E_set_Esterase_N	6.29e-11	313	373	3	63	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd02688	E_set	3.21e-09	313	372	2	66	Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus. The E or "early" set domains of sugar utilizing enzymes are associated with different types of catalytic domains at either the N-terminal or C-terminal end. These domains may be related to the immunoglobulin and/or fibronectin type III superfamilies. Members of this family include alpha amylase, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. A subset of these members were recently identified as members of the CBM48 (Carbohydrate Binding Module 48) family. Members of the CBM48 family include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.
cd02859	E_set_AMPKbeta_like_N	1.57e-08	312	376	1	68	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM11109.1	1.61e-109	1	372	1	363
BCS85270.1	3.65e-107	19	372	27	376
QNL40592.1	1.56e-106	1	372	1	363
QUT32423.1	4.75e-106	1	372	1	366
QRM99006.1	1.88e-105	1	372	1	366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	9.35e-89	18	370	40	394	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000542	0.998646	0.000291	0.000182	0.000170	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003445_01027.