CAZyme Information: MGYG000003505_00366

Basic Information

• Species: CAG-977 sp900768845
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; CAG-977; CAG-977 sp900768845
• CAZyme ID: MGYG000003505_00366
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		42435.13	9.0585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003505	2316811	MAG	Fiji	Oceania

• Gene Location: Start: 95349; End: 96512 Strand: +

Full Sequence      

MDDVTVYLIAGEPSGDLLASRLMRALKDKTGGKIRFEGVGGETMAEQGFHSLFDSSELAV
MGLAEVIPSIPRIMRRINETVADIVAKKPDAVVTVDSWSFSARVNKKLKALNTGIPQIHY
VAPQVWAWKKRRAKTCGRYIDRLLALLPYEPRYFEPYGLKTDFIGHPVVEGGAAKGDGNG
FRARYGISEKAPLLCVLPGSRRSEIKYLLPVFKETVAILARKYPDMRLVVPSVVTVEKTV
REAVSDWALPVEVVSGEAARYDAFAASSAALAASGTVALELAMARVPYTVTYKMNPVSTF
LAHRLVSGKFVNLVNILADREIVREYILENCRPALLAAEIERLLDNESYRNAEVEAAFDV
LKTLGAAGDETPSGKAADVVLEYARKK

Enzyme Prediction     

No EC number prediction in MGYG000003505_00366.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	361	5.6e-118	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.15e-132	5	387	3	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.24e-131	5	386	3	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.01e-100	6	354	1	349	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.78e-76	5	383	7	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.61e-50	10	364	8	328	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	1.20e-136	2	387	3	387
BAE51288.1	2.16e-135	6	386	3	383
ARJ65449.1	3.37e-133	6	387	8	389
CUW40282.1	4.45e-131	6	387	8	389
AUN29831.1	1.23e-128	6	385	6	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.00e-64	4	385	7	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.82e-64	4	385	7	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	4.32e-136	6	386	3	383	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	8.70e-126	1	387	1	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	5.71e-95	6	380	31	402	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	7.44e-93	6	382	6	389	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q3SRI5	1.31e-85	6	386	13	391	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003505_00366.