CAZyme Information: MGYG000003509_00858

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000003509_00858
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000003509_365|CGC1	56389.12	8.1643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003509	1280127	MAG	Fiji	Oceania

• Gene Location: Start: 925; End: 2406 Strand: +

Full Sequence      

MPLRDKNRKRSSGVLCAISSLPSDYGIGTFGEQAYKFIDFLAEGKQRFWQILPLNPLGEG
NSPYKSISCFAGEILYIDIDFLVRDGLLNQSDIGEYEYTVKVDYNAVRRFKIPLISKAAE
NLDSGNGKYRRFLRENGWWLNDYAIFAAALSFYKTKKLTDLPDGIKYRIPGDLQNFKNKH
CAEINFYKTVQYLFYSQYFALKDYANKKGVKIIGDIPFYVSADSADVWVNPDDFKVGRDF
TPMAVAGVPPDIFSEKGQLWGNPIYNLQNMKKNEYKWWCSRLAFCKDLYDVLRVDHFRAF
ANYYSVPYGTENAISGSWQKGSGEDFWNIAAEKIGRIKIIAEDLGGEDDPDVISLLKYTD
FPNMKILQFGFTGDMQNAFLPQNYGYNCVCYTGTHDNNTSLGWYENASKRQKAVFNAIIK
DNEYSVPHRMIRALSKSQSMLCIIPMQDILCLDADARMNTPGTKRGNWQWQMSADAINGD
IANTLKKLTKERN

Enzyme Prediction     

No EC number prediction in MGYG000003509_00858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	18	490	6.4e-149	0.9858299595141701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	7	490	2	492	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	18	475	3	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	5.10e-167	1	493	20	524	disproportionating enzyme
COG1640	MalQ	2.56e-136	3	493	7	517	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	4.60e-123	7	493	11	512	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL12364.1	1.34e-146	9	489	4	490
QNM01603.1	5.92e-146	6	490	2	493
QJA09593.1	3.92e-145	10	490	2	488
ASW44505.1	1.29e-144	9	490	2	486
BBM36735.1	3.60e-144	9	490	3	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M6T_A	3.69e-123	8	489	3	491	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1X1N_A	5.60e-118	1	488	17	514	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.60e-117	1	488	69	566	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
5CPQ_A	3.61e-114	1	472	61	538	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
2X1I_A	1.08e-111	13	490	8	495	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	8.07e-131	18	490	3	481	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q0	3.24e-129	8	489	2	490	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	3.24e-129	8	489	2	490	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
Q06801	1.43e-116	1	488	69	566	4-alpha-glucanotransferase, chloroplastic/amyloplastic OS=Solanum tuberosum OX=4113 GN=DPEP PE=1 SV=1
Q9LV91	2.79e-113	1	472	73	550	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003509_00858.