CAZyme Information: MGYG000003510_00819

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA6857
• CAZyme ID: MGYG000003510_00819
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		57008.01	5.0034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003510	1907667	MAG	Fiji	Oceania

• Gene Location: Start: 6895; End: 8394 Strand: -

Full Sequence      

MNHKRTAGVLLHLSSLNGPFSVGVMGKEAFAFVDKLQRTGFSLWQMLPLCPVDHTGSPYC
SVSAFAGNVAFIDPRLLKAEGLVTDEEVRENEYHGSEFAADWEFAVQKRLALLKKAFLRI
DDDTRQLISIFAGQNDWVRPFALFSALKDYHNQRPWWEWEDRFAHYETALAHADEFEEET
QFYIFTQYVFFTQFRSLKEYANSHGISIMGDMPIYVSRDSADVWSNTELFLLDKVTLAPS
KVAGVPPDYFSEDGQLWGNPLYDWEKMEKDGYRWWIKRIGAALKLFDRVRIDHFRAFASY
WAVPAESETAKNGEWLKGPGMKLFEKIRSALPQSDIVAEDLGTFGEDVVKLLEDTNFPGM
RVIQFGFDVHSNSTHLPHNYDKNCVAYVGTHDNNTILGWLWEASEQERAFALRYCCFGGN
NWGEGGFYSGSCRAVIEAVWRSSAQTAVVAVQDMCGFGSDARMNRPGTSEDNWSFRITQG
ALDGIDESYFREINSVYRR

Enzyme Prediction     

No EC number prediction in MGYG000003510_00819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	489	9.3e-153	0.97165991902834

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	499	1	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	11	478	1	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	3.52e-160	4	499	27	525	disproportionating enzyme
COG1640	MalQ	3.20e-145	4	499	13	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	1.95e-124	1	483	10	497	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38582.1	3.44e-177	1	499	1	505
QCT73240.1	4.54e-175	1	499	1	505
ARD65542.1	4.54e-175	1	499	1	505
ALU15685.1	1.96e-159	40	499	2	467
AWW25287.1	5.51e-158	5	499	6	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CPQ_A	9.00e-126	4	499	69	563	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
6M6T_A	2.00e-124	1	499	1	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1TZ7_A	3.00e-123	2	499	19	503	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
1X1N_A	1.08e-119	2	499	23	523	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
1CWY_A	4.13e-119	1	482	1	482	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	3.27e-137	11	499	1	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q0	8.75e-131	4	499	3	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	8.75e-131	4	499	3	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
Q9LV91	7.05e-125	4	499	81	575	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1
O66937	7.02e-122	5	499	2	483	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003510_00819.