CAZyme Information: MGYG000003581_02260

Basic Information

• Species: HGM12814 sp900770165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; HGM12814; HGM12814 sp900770165
• CAZyme ID: MGYG000003581_02260
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		42116.63	8.0705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003581	2356172	MAG	Fiji	Oceania

• Gene Location: Start: 11506; End: 12597 Strand: +

Full Sequence      

MSFKVFHIVTHFDIGGSETVALNISKAKCPNVEFHMVEVVKGKGAYSKAFIEDLESNGIY
YHHSPFSTNFILGALLFPFWFWKLHLKYHPDVYHSHTESPDVALYLFFLLFGFMINKNVK
VVRTLHNTKLWKHKHFIGKVIEHFFLKHQANVSISGPVRESYLYDFPFYHKTIPIIYNGI
AEKKQLKFEGIRDGKINILFAGRIVEQKGISVLSAVINKLNTHINTFYFHIVGEGHLKED
LVKELGIFENVHFYGNVYNLAQYLHSFDFLFMPSVHEGLSMLSIESSFAKLPIIINSCEG
LVDTVPNAWPLKVKDNNVDDFVEVFNNIKNLDRKVLAESAYQFVSDRFGIEQMQNQYIEY
YKR

Enzyme Prediction     

No EC number prediction in MGYG000003581_02260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	327	5.3e-21	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	8.18e-38	4	362	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03807	GT4_WbnK-like	4.50e-34	4	362	1	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03811	GT4_GT28_WabH-like	1.83e-32	4	350	1	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	6.68e-30	1	363	1	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	1.96e-24	4	357	1	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35907.1	3.39e-107	4	362	2	355
QQA28752.1	3.39e-107	4	362	2	355
QUR43376.1	1.04e-104	4	362	3	358
QUT46532.1	2.97e-103	4	363	2	357
QRO26042.1	1.81e-102	4	363	2	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XYW_A	7.73e-11	181	349	173	329	GlycosyltransferasesWbnH [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48453	1.07e-17	86	362	70	356	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
P0DMP6	4.23e-10	181	349	173	329	O-antigen biosynthesis glycosyltransferase WbnH OS=Escherichia coli OX=562 GN=wbnH PE=1 SV=1
P0DMP7	4.23e-10	181	349	173	329	Probable O-antigen biosynthesis glycosyltransferase WbiN OS=Escherichia coli OX=562 GN=wbiN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
60	82
102	119