CAZyme Information: MGYG000003582_00786

Basic Information

• Species: Firm-07 sp900770145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; Firm-07; Firm-07 sp900770145
• CAZyme ID: MGYG000003582_00786
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22063.88	4.8025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003582	1806619	MAG	Fiji	Oceania

• Gene Location: Start: 12; End: 608 Strand: -

Full Sequence      

MAAFLTLTLLVLITALALVTAGGIYVWNLDTDVDAELFETAKGDKTTRLYYTDADSNERE
LAADRISGYENALYCPLADMPENLKNAFIAIEDKRFFEHAGIDWVRTGGAVRNYLLHGST
GYGGSTITQQLIKNLTGEDERNISRKAAELVRAAKTEQRYSKEEILEIYLNVVNLSENCY
GVRTAANAYFSKDRKSVV

Enzyme Prediction     

No EC number prediction in MGYG000003582_00786.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	70	195	1.5e-46	0.7062146892655368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.04e-57	68	193	9	134	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.15e-47	17	193	25	198	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.74e-37	19	192	20	187	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	1.42e-31	74	190	47	162	glycosyltransferase; Provisional
PRK00056	mtgA	1.77e-28	76	193	64	181	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ23201.1	1.77e-43	3	197	30	225
CDZ23183.1	1.61e-41	3	197	33	227
CAB1249043.1	7.73e-41	46	193	78	222
BAK99350.1	9.85e-39	10	193	37	222
CBF97356.1	5.95e-38	46	193	75	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.39e-24	68	192	16	140	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	9.41e-24	68	192	16	140	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	1.11e-23	34	197	4	163	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	3.45e-23	77	197	32	152	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	8.93e-23	77	197	41	161	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q891X1	2.72e-24	79	197	87	209	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
P39793	2.80e-24	55	190	81	213	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
P40750	4.65e-24	50	197	57	201	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
P38050	1.69e-23	70	197	65	192	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q00573	5.56e-23	17	197	24	199	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.642598	0.352486	0.002728	0.000573	0.000374	0.001234

TMHMM  Annotations     

start	end
7	29