CAZyme Information: MGYG000003590_01019

Basic Information

• Species: Sodaliphilus sp900770215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus; Sodaliphilus sp900770215
• CAZyme ID: MGYG000003590_01019
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230		26127.77	5.0809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003590	3134564	MAG	Fiji	Oceania

• Gene Location: Start: 231; End: 923 Strand: -

Full Sequence      

MMIPKVIHYCWFGRGAKPKLARKCIASWQKYLPDYEVKEWNEDNFDVNHNAYTAQAMEER
KYAYVSDYARMWILYNEGGLYFDTDVEVVAPLDDIVAQGPFMGIEGVRPGGDAMVDVNPG
LGLGACPGLGIYEEILQLYEQEGLDCAGYIVPFATQVMAQHGIEPVDALQVVDGITVYPH
DYFNPYDYLTGRLNTTANTRSIHWYGASWLSPWGRLKLRLGRQLRKLTAR

Enzyme Prediction     

No EC number prediction in MGYG000003590_01019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	97	1.5e-22	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.44e-17	2	209	81	279	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.72e-15	18	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.75e-10	2	101	45	149	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	5.17e-04	29	85	127	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA75301.1	9.29e-86	2	220	1	226
QJR59783.1	9.29e-86	2	220	1	226
QJR55418.1	9.29e-86	2	220	1	226
AII69495.1	9.29e-86	2	220	1	226
QUU04252.1	1.08e-79	2	229	1	232

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003590_01019.